DUF3301 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3301 - Protein of unknown function (DUF3301)

PFAM:	PF11743	Sequences: LLLLLLLLAAAAWFWLSLRARERALAAARRACERAGLQLLDDTVALRRLRLARDDDGRLRLRRTYRFEFSDTGDNRRQGSVVLLGRRVESVELPP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	95 (93)
Sequences:	4221 (2824)
Seq/√Len:	292.9
META:	0.89

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_A	62_R	2.807	1.00
54_D	60_R	2.611	1.00
72_T	75_N	2.413	1.00
48_R	64_T	2.250	1.00
18_L	21_R	2.176	1.00
54_D	58_R	2.165	1.00
27_A	88_V	2.093	1.00
47_R	66_R	2.066	1.00
64_T	82_V	2.062	1.00
29_R	42_D	1.992	1.00
31_A	91_V	1.976	1.00
30_R	34_R	1.945	1.00
71_D	75_N	1.939	1.00
50_R	62_R	1.913	1.00
71_D	77_R	1.795	1.00
12_A	16_L	1.744	1.00
70_S	75_N	1.683	1.00
13_W	16_L	1.628	1.00
80_S	92_E	1.580	1.00
52_A	84_L	1.536	1.00
25_L	42_D	1.517	1.00
30_R	33_E	1.499	1.00
51_L	59_L	1.491	1.00
41_D	76_R	1.463	1.00
16_L	19_R	1.457	1.00
26_A	30_R	1.451	1.00
66_R	78_Q	1.364	1.00
20_A	83_L	1.352	1.00
21_R	25_L	1.343	1.00
68_E	78_Q	1.321	1.00
84_L	89_E	1.303	1.00
53_R	57_G	1.286	1.00
23_R	26_A	1.254	1.00
37_L	71_D	1.243	1.00
29_R	33_E	1.241	1.00
62_R	84_L	1.234	1.00
53_R	59_L	1.226	1.00
28_A	39_L	1.224	1.00
14_F	17_S	1.214	1.00
9_A	13_W	1.187	1.00
19_R	22_E	1.184	1.00
31_A	35_A	1.160	1.00
40_L	76_R	1.114	1.00
25_L	28_A	1.104	1.00
62_R	82_V	1.096	1.00
3_L	7_L	1.080	1.00
64_T	80_S	1.070	1.00
28_A	81_V	1.067	1.00
69_F	94_P	1.046	1.00
25_L	39_L	1.041	1.00
8_L	12_A	1.032	1.00
37_L	69_F	1.025	1.00
46_L	49_L	1.013	1.00
62_R	89_E	1.011	1.00
60_R	84_L	1.004	1.00
70_S	73_G	1.001	1.00
24_A	81_V	0.995	1.00
25_L	69_F	0.991	1.00
18_L	22_E	0.975	1.00
4_L	8_L	0.973	1.00
67_F	79_G	0.953	1.00
39_L	43_T	0.951	1.00
23_R	86_R	0.935	1.00
27_A	31_A	0.921	1.00
31_A	34_R	0.902	1.00
26_A	33_E	0.896	1.00
79_G	93_L	0.864	1.00
23_R	27_A	0.857	1.00
25_L	29_R	0.847	1.00
81_V	91_V	0.847	1.00
10_A	14_F	0.841	1.00
27_A	81_V	0.813	1.00
22_E	44_V	0.788	0.99
63_R	76_R	0.778	0.99
51_L	61_L	0.754	0.99
59_L	84_L	0.754	0.99
51_L	65_Y	0.742	0.99
82_V	90_S	0.738	0.99
21_R	44_V	0.730	0.99
49_L	61_L	0.725	0.99
24_A	83_L	0.721	0.99
28_A	46_L	0.710	0.99
9_A	12_A	0.710	0.99
17_S	63_R	0.703	0.99
21_R	43_T	0.700	0.99
31_A	93_L	0.697	0.99
14_F	61_L	0.691	0.99
4_L	16_L	0.679	0.98
32_C	79_G	0.674	0.98
26_A	29_R	0.672	0.98
35_A	90_S	0.669	0.98
52_A	89_E	0.664	0.98
33_E	36_G	0.660	0.98
41_D	44_V	0.655	0.98
41_D	68_E	0.649	0.98
42_D	68_E	0.642	0.98
69_F	79_G	0.641	0.98
54_D	57_G	0.635	0.97
31_A	69_F	0.614	0.97
25_L	43_T	0.611	0.97
10_A	33_E	0.610	0.97
80_S	90_S	0.609	0.97
45_A	68_E	0.603	0.96
40_L	63_R	0.599	0.96
17_S	65_Y	0.596	0.96
2_L	12_A	0.596	0.96
69_F	93_L	0.594	0.96
38_Q	42_D	0.578	0.96
13_W	17_S	0.578	0.96
25_L	65_Y	0.576	0.95
49_L	64_T	0.571	0.95
20_A	63_R	0.565	0.95
83_L	88_V	0.564	0.95
22_E	45_A	0.563	0.95
78_Q	94_P	0.562	0.95
27_A	30_R	0.561	0.95
42_D	46_L	0.554	0.94
24_A	88_V	0.554	0.94
11_A	15_W	0.554	0.94
69_F	77_R	0.550	0.94
66_R	80_S	0.549	0.94
21_R	41_D	0.541	0.94
39_L	42_D	0.538	0.94
91_V	94_P	0.538	0.94
41_D	46_L	0.538	0.94
28_A	44_V	0.537	0.93
45_A	83_L	0.527	0.93
46_L	65_Y	0.524	0.93
82_V	89_E	0.522	0.92
39_L	44_V	0.519	0.92
28_A	37_L	0.519	0.92
63_R	67_F	0.512	0.92
68_E	73_G	0.510	0.92
41_D	63_R	0.507	0.91
28_A	91_V	0.506	0.91
21_R	45_A	0.506	0.91
88_V	91_V	0.504	0.91
74_D	77_R	0.504	0.91
90_S	94_P	0.502	0.91
69_F	75_N	0.500	0.91

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l2tA	2	0.2632	18.8	0.905	Contact Map
2jwaA	2	0.2421	13.7	0.911	Contact Map
2ks1B	1	0.2526	11.1	0.914	Contact Map
2l9uA	2	0.2632	8.7	0.918	Contact Map
2mfrA	1	0.3368	6.8	0.922	Contact Map
2fyfA	2	0.0632	6.2	0.923	Contact Map
1d3bA	1	0.6421	5.4	0.926	Contact Map
4rp9A	2	0.2737	5.3	0.926	Contact Map
3lb6C	1	0	5	0.927	Contact Map
1iijA	1	0.1895	4.6	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.