DUF3262 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3262 - Protein of unknown function (DUF3262)

PFAM:	PF11660	Sequences: MTAAQLAAFQAASGGFTPAALSLLIAGIVFALLLLWGAWALLTAYRGWAEGRLSLRDFLGVAVRAVLLLLVLGFFLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	77 (75)
Sequences:	693 (486)
Seq/√Len:	56.2
META:	0.665

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_G	65_A	6.183	1.00
41_L	62_A	3.356	1.00
44_A	61_V	3.242	1.00
12_A	36_W	3.229	1.00
2_T	5_Q	2.599	1.00
24_L	28_I	2.018	1.00
40_A	65_A	2.016	1.00
21_L	25_I	2.015	1.00
45_Y	49_A	1.986	1.00
64_R	71_V	1.871	1.00
63_V	67_L	1.798	0.99
30_F	73_G	1.754	0.99
6_L	18_P	1.509	0.98
44_A	58_F	1.407	0.96
24_L	27_G	1.357	0.96
40_A	76_L	1.294	0.94
58_F	70_L	1.284	0.94
22_S	26_A	1.259	0.94
16_F	24_L	1.212	0.92
46_R	50_E	1.210	0.92
29_V	76_L	1.191	0.91
10_Q	13_S	1.185	0.91
40_A	49_A	1.179	0.91
46_R	49_A	1.165	0.91
21_L	46_R	1.156	0.90
9_F	39_W	1.132	0.89
5_Q	36_W	1.104	0.88
51_G	75_F	1.104	0.88
2_T	6_L	1.085	0.87
8_A	61_V	1.079	0.87
46_R	51_G	1.062	0.86
25_I	32_L	1.045	0.85
20_A	70_L	1.005	0.83
37_G	68_L	0.989	0.82
16_F	21_L	0.958	0.80
34_L	38_A	0.950	0.79
17_T	20_A	0.947	0.79
42_L	46_R	0.946	0.79
34_L	69_L	0.916	0.76
44_A	71_V	0.908	0.76
56_R	59_L	0.899	0.75
58_F	75_F	0.896	0.75
9_F	72_L	0.889	0.74
3_A	63_V	0.882	0.74
69_L	72_L	0.879	0.73
31_A	48_W	0.876	0.73
19_A	66_V	0.872	0.73
33_L	57_D	0.869	0.73
41_L	66_V	0.864	0.72
36_W	45_Y	0.862	0.72
26_A	64_R	0.854	0.71
10_Q	17_T	0.845	0.70
21_L	76_L	0.831	0.69
29_V	66_V	0.831	0.69
3_A	6_L	0.830	0.69
40_A	44_A	0.828	0.69
9_F	21_L	0.826	0.69
33_L	68_L	0.800	0.66
51_G	67_L	0.786	0.65
14_G	29_V	0.782	0.64
32_L	71_V	0.775	0.64
40_A	47_G	0.774	0.64
58_F	69_L	0.769	0.63
7_A	10_Q	0.753	0.61
26_A	65_A	0.750	0.61
47_G	53_L	0.725	0.59
47_G	61_V	0.720	0.58
6_L	59_L	0.713	0.57
62_A	71_V	0.711	0.57
54_S	63_V	0.709	0.57
30_F	70_L	0.693	0.55
43_T	46_R	0.670	0.53
3_A	7_A	0.665	0.52
48_W	69_L	0.658	0.51
21_L	63_V	0.647	0.50
6_L	62_A	0.638	0.49
4_A	19_A	0.636	0.49
2_T	50_E	0.636	0.49
37_G	69_L	0.635	0.49
30_F	34_L	0.627	0.48
19_A	38_A	0.626	0.48
22_S	68_L	0.623	0.48
8_A	12_A	0.608	0.46
46_R	67_L	0.601	0.45
1_M	4_A	0.598	0.45
18_P	47_G	0.597	0.45
52_R	76_L	0.585	0.43
52_R	55_L	0.568	0.42
4_A	7_A	0.563	0.41
32_L	57_D	0.555	0.40
5_Q	39_W	0.552	0.40
7_A	20_A	0.539	0.39
35_L	53_L	0.535	0.38
43_T	50_E	0.533	0.38
45_Y	48_W	0.531	0.38
18_P	39_W	0.531	0.38
70_L	74_F	0.530	0.38
21_L	34_L	0.526	0.37
55_L	63_V	0.526	0.37
2_T	12_A	0.523	0.37
38_A	56_R	0.520	0.37
25_I	60_G	0.518	0.36
14_G	39_W	0.518	0.36
36_W	64_R	0.517	0.36
49_A	54_S	0.516	0.36
31_A	45_Y	0.513	0.36
46_R	63_V	0.510	0.36
19_A	50_E	0.510	0.36
48_W	51_G	0.506	0.35
21_L	58_F	0.505	0.35
13_S	20_A	0.504	0.35
4_A	17_T	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ayfA	2	0.987	18	0.844	Contact Map
4hw9A	3	0.7013	7.1	0.87	Contact Map
3ox6A	2	0.8312	3.6	0.887	Contact Map
1s6jA	1	0.8182	3.2	0.89	Contact Map
4mzjA	1	0.7922	2.9	0.893	Contact Map
2gsmB	1	0.974	2.8	0.893	Contact Map
5ajiA	3	0.8052	2.6	0.895	Contact Map
1v54B	1	0.987	2.4	0.897	Contact Map
2kogA	1	0.5325	2.4	0.897	Contact Map
2pmyA	4	0.8182	2.3	0.898	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.