DUF3189 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3189 - Protein of unknown function (DUF3189)

PFAM:	PF11385	Sequences: KIIYHCYGGTHSSVVAAAIHLGLLPEDRIPTKEEILNLPYFDKLTKKDIGKLIFMGTDEEGNEVYTLGRRGAGKLVEPALKSLLEILGIPEEEILFVDTLPTVNLLMRIGGFLSRRLGLVSIGRPLVVKGTRKAYPNIVKLVEEVKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	147 (145)
Sequences:	738 (615)
Seq/√Len:	51.1
META:	0.709

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_C	13_S	4.565	1.00
28_R	34_E	3.979	1.00
4_Y	20_H	3.643	1.00
15_V	131_T	3.404	1.00
3_I	52_L	2.920	1.00
110_G	123_G	2.661	1.00
25_P	28_R	2.631	1.00
57_T	63_E	2.533	1.00
42_D	124_R	2.324	1.00
129_K	132_R	2.313	1.00
26_E	146_K	2.192	1.00
30_P	135_Y	2.161	1.00
115_R	124_R	2.149	1.00
107_M	131_T	2.070	1.00
129_K	133_K	1.997	1.00
106_L	133_K	1.874	0.99
23_L	39_P	1.841	0.99
106_L	129_K	1.786	0.99
19_I	24_L	1.773	0.99
110_G	130_G	1.736	0.99
54_F	65_Y	1.721	0.99
49_I	70_R	1.705	0.99
76_V	79_A	1.683	0.98
135_Y	139_V	1.656	0.98
17_A	55_M	1.625	0.98
69_R	73_G	1.598	0.98
8_G	11_H	1.543	0.97
59_E	146_K	1.524	0.97
113_L	122_I	1.511	0.97
134_A	137_N	1.499	0.97
132_R	136_P	1.471	0.96
55_M	66_T	1.459	0.96
2_I	95_L	1.425	0.96
123_G	130_G	1.420	0.96
11_H	42_D	1.418	0.96
42_D	111_G	1.415	0.95
58_D	62_N	1.401	0.95
25_P	135_Y	1.383	0.95
54_F	57_T	1.365	0.95
8_G	111_G	1.329	0.94
10_T	44_L	1.329	0.94
7_Y	68_G	1.328	0.94
100_L	108_R	1.283	0.92
32_K	128_V	1.246	0.91
44_L	49_I	1.244	0.91
41_F	127_V	1.218	0.90
16_A	142_V	1.214	0.90
111_G	114_S	1.183	0.89
113_L	119_L	1.182	0.89
29_I	132_R	1.162	0.88
16_A	138_I	1.153	0.88
6_C	9_G	1.141	0.87
26_E	143_E	1.141	0.87
131_T	134_A	1.135	0.87
63_E	68_G	1.133	0.87
52_L	70_R	1.124	0.86
97_V	141_L	1.110	0.86
15_V	35_I	1.108	0.86
97_V	145_V	1.106	0.85
19_I	30_P	1.101	0.85
52_L	107_M	1.094	0.85
114_S	123_G	1.074	0.84
120_V	124_R	1.073	0.84
90_P	140_K	1.068	0.83
8_G	12_S	1.067	0.83
8_G	13_S	1.041	0.82
112_F	117_L	1.035	0.81
102_T	141_L	1.017	0.80
113_L	126_L	1.016	0.80
99_T	102_T	1.000	0.79
19_I	135_Y	0.995	0.79
11_H	114_S	0.986	0.78
107_M	127_V	0.985	0.78
13_S	19_I	0.978	0.78
136_P	143_E	0.974	0.77
12_S	103_V	0.972	0.77
42_D	114_S	0.965	0.77
83_L	86_I	0.958	0.76
79_A	82_S	0.943	0.75
127_V	131_T	0.942	0.75
136_P	140_K	0.940	0.75
12_S	107_M	0.936	0.74
12_S	99_T	0.929	0.74
114_S	124_R	0.927	0.74
42_D	120_V	0.914	0.73
67_L	76_V	0.911	0.72
77_E	81_K	0.907	0.72
62_N	121_S	0.904	0.72
18_A	23_L	0.901	0.72
11_H	124_R	0.898	0.71
104_N	130_G	0.892	0.71
85_E	93_E	0.873	0.69
103_V	111_G	0.872	0.69
115_R	120_V	0.864	0.68
111_G	123_G	0.863	0.68
5_H	96_F	0.857	0.68
83_L	87_L	0.850	0.67
77_E	96_F	0.850	0.67
64_V	105_L	0.849	0.67
18_A	55_M	0.845	0.67
22_G	59_E	0.839	0.66
45_T	48_D	0.835	0.66
40_Y	55_M	0.827	0.65
122_I	140_K	0.820	0.64
36_L	128_V	0.813	0.64
114_S	125_P	0.813	0.64
14_V	66_T	0.807	0.63
37_N	143_E	0.804	0.63
85_E	144_E	0.794	0.62
9_G	13_S	0.791	0.61
38_L	67_L	0.785	0.61
78_P	93_E	0.766	0.59
104_N	107_M	0.762	0.59
42_D	130_G	0.761	0.58
128_V	132_R	0.760	0.58
100_L	103_V	0.759	0.58
136_P	139_V	0.758	0.58
69_R	107_M	0.755	0.58
38_L	98_D	0.753	0.58
16_A	99_T	0.751	0.57
103_V	107_M	0.746	0.57
88_G	140_K	0.738	0.56
17_A	66_T	0.736	0.56
94_I	105_L	0.734	0.56
111_G	124_R	0.733	0.56
37_N	91_E	0.732	0.55
67_L	90_P	0.731	0.55
10_T	83_L	0.731	0.55
80_L	84_L	0.729	0.55
46_K	75_L	0.726	0.55
19_I	29_I	0.724	0.55
28_R	31_T	0.722	0.54
4_Y	12_S	0.719	0.54
17_A	29_I	0.719	0.54
64_V	72_A	0.718	0.54
42_D	103_V	0.718	0.54
75_L	87_L	0.715	0.54
5_H	70_R	0.712	0.53
2_I	97_V	0.709	0.53
6_C	11_H	0.703	0.53
94_I	109_I	0.700	0.52
77_E	109_I	0.699	0.52
40_Y	53_I	0.698	0.52
80_L	91_E	0.686	0.51
18_A	38_L	0.677	0.50
37_N	144_E	0.675	0.50
104_N	134_A	0.674	0.49
122_I	125_P	0.673	0.49
42_D	115_R	0.670	0.49
45_T	118_G	0.664	0.48
9_G	107_M	0.654	0.47
9_G	41_F	0.650	0.47
47_K	144_E	0.650	0.47
4_Y	58_D	0.647	0.47
8_G	114_S	0.645	0.46
20_H	64_V	0.644	0.46
6_C	12_S	0.642	0.46
2_I	78_P	0.642	0.46
52_L	72_A	0.638	0.46
48_D	51_K	0.637	0.46
18_A	65_Y	0.635	0.45
21_L	112_F	0.630	0.45
4_Y	56_G	0.629	0.45
115_R	123_G	0.619	0.44
5_H	69_R	0.615	0.43
6_C	21_L	0.608	0.43
111_G	115_R	0.607	0.43
3_I	6_C	0.605	0.42
76_V	93_E	0.604	0.42
15_V	126_L	0.602	0.42
44_L	66_T	0.601	0.42
61_G	74_K	0.600	0.42
83_L	90_P	0.595	0.41
9_G	68_G	0.594	0.41
28_R	135_Y	0.593	0.41
11_H	111_G	0.591	0.41
64_V	101_P	0.591	0.41
69_R	127_V	0.580	0.40
12_S	114_S	0.578	0.40
5_H	73_G	0.565	0.38
78_P	122_I	0.565	0.38
82_S	87_L	0.565	0.38
35_I	81_K	0.561	0.38
20_H	65_Y	0.559	0.38
140_K	143_E	0.557	0.38
84_L	89_I	0.557	0.38
10_T	100_L	0.557	0.38
11_H	130_G	0.557	0.38
120_V	138_I	0.553	0.37
103_V	131_T	0.549	0.37
110_G	114_S	0.548	0.37
7_Y	11_H	0.547	0.37
13_S	114_S	0.547	0.37
30_P	139_V	0.546	0.37
2_I	104_N	0.543	0.36
73_G	80_L	0.536	0.36
21_L	55_M	0.535	0.36
105_L	109_I	0.531	0.35
13_S	42_D	0.523	0.34
140_K	144_E	0.522	0.34
75_L	143_E	0.521	0.34
26_E	139_V	0.521	0.34
126_L	140_K	0.520	0.34
31_T	59_E	0.518	0.34
82_S	100_L	0.517	0.34
11_H	123_G	0.517	0.34
33_E	60_E	0.512	0.33
60_E	120_V	0.511	0.33
28_R	37_N	0.508	0.33
81_K	140_K	0.507	0.33
33_E	37_N	0.507	0.33
107_M	130_G	0.506	0.33
53_I	67_L	0.504	0.33
7_Y	70_R	0.503	0.33
14_V	55_M	0.502	0.32
42_D	108_R	0.502	0.32
94_I	117_L	0.501	0.32
60_E	85_E	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1uarA	1	0.3265	32.9	0.92	Contact Map
1urhA	1	0.2381	31.6	0.92	Contact Map
3hzuA	2	0.3537	29.2	0.922	Contact Map
3d1pA	1	0.3197	23.9	0.925	Contact Map
2m6rA	1	0.8095	21.8	0.926	Contact Map
4rb5B	1	0.7551	20.7	0.927	Contact Map
3aayA	1	0.3333	19.8	0.928	Contact Map
2isbA	1	0.415	19.2	0.928	Contact Map
1jbiA	1	0.4558	18	0.929	Contact Map
1xhjA	1	0.5578	14.9	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.