DUF3185 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3185 - Protein of unknown function (DUF3185)

PFAM:	PF11381	Sequences: KIIGIALLVVGIVLLIFGYNASDSFGSQVSRFFTGSPTDKTMWLLIGGAVAAVVGLVLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	59 (58)
Sequences:	4292 (2826)
Seq/√Len:	371.1
META:	0.958

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_G	58_L	3.038	1.00
25_F	29_V	2.560	1.00
12_I	16_I	2.473	1.00
8_L	52_A	2.200	1.00
19_Y	23_D	2.071	1.00
15_L	52_A	1.961	1.00
7_L	51_A	1.945	1.00
28_Q	31_R	1.870	1.00
16_I	20_N	1.831	1.00
43_W	47_G	1.615	1.00
42_M	46_I	1.501	1.00
21_A	41_T	1.470	1.00
11_G	48_G	1.458	1.00
22_S	25_F	1.388	1.00
27_S	37_P	1.374	1.00
37_P	41_T	1.350	1.00
52_A	56_L	1.349	1.00
13_V	17_F	1.321	1.00
27_S	38_T	1.305	1.00
40_K	44_L	1.299	1.00
27_S	41_T	1.290	1.00
15_L	49_A	1.280	1.00
19_Y	45_L	1.248	1.00
36_S	40_K	1.202	1.00
49_A	53_V	1.188	1.00
2_I	6_A	1.159	1.00
15_L	48_G	1.131	1.00
30_S	38_T	1.127	1.00
41_T	44_L	1.074	1.00
41_T	45_L	1.042	1.00
51_A	58_L	1.036	1.00
11_G	52_A	1.015	1.00
29_V	32_F	1.012	1.00
10_V	50_V	0.965	1.00
16_I	19_Y	0.927	1.00
28_Q	32_F	0.907	1.00
5_I	8_L	0.893	1.00
26_G	29_V	0.861	1.00
20_N	23_D	0.856	1.00
21_A	40_K	0.817	1.00
23_D	28_Q	0.810	1.00
24_S	27_S	0.787	1.00
17_F	42_M	0.760	1.00
10_V	51_A	0.756	1.00
39_D	42_M	0.755	1.00
47_G	51_A	0.751	1.00
45_L	49_A	0.749	1.00
9_V	13_V	0.712	1.00
6_A	10_V	0.711	0.99
27_S	30_S	0.710	0.99
36_S	41_T	0.709	0.99
15_L	45_L	0.709	0.99
14_L	47_G	0.706	0.99
31_R	37_P	0.704	0.99
22_S	45_L	0.700	0.99
18_G	45_L	0.694	0.99
21_A	44_L	0.693	0.99
22_S	41_T	0.691	0.99
15_L	19_Y	0.691	0.99
21_A	27_S	0.683	0.99
7_L	54_V	0.679	0.99
13_V	49_A	0.679	0.99
4_G	10_V	0.674	0.99
8_L	56_L	0.671	0.99
23_D	31_R	0.669	0.99
47_G	54_V	0.668	0.99
30_S	33_F	0.652	0.99
22_S	28_Q	0.650	0.99
17_F	44_L	0.639	0.99
5_I	9_V	0.638	0.99
38_T	41_T	0.625	0.99
14_L	44_L	0.605	0.98
15_L	43_W	0.597	0.98
3_I	10_V	0.590	0.98
48_G	55_G	0.586	0.98
50_V	57_V	0.574	0.98
22_S	42_M	0.572	0.98
18_G	41_T	0.561	0.97
21_A	36_S	0.559	0.97
46_I	50_V	0.558	0.97
22_S	37_P	0.546	0.97
53_V	57_V	0.539	0.97
50_V	54_V	0.538	0.97
23_D	26_G	0.538	0.97
12_I	35_G	0.503	0.95
17_F	21_A	0.502	0.95
23_D	36_S	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ayfA	2	0.9831	41.6	0.74	Contact Map
4o6yA	2	0.9661	24.2	0.77	Contact Map
3b5dA	2	0.322	11.8	0.8	Contact Map
4p79A	1	0.8644	11.1	0.803	Contact Map
3x29A	1	0.7627	10.4	0.806	Contact Map
2i68A	2	0.3051	8.8	0.812	Contact Map
3ux4A	3	0.8136	5.8	0.827	Contact Map
3c75L	1	0	5.2	0.831	Contact Map
4a2nB	1	0.9661	5.1	0.831	Contact Map
3j1zP	8	0.8305	4.9	0.832	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.