Stealth_CR2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Stealth_CR2 - Stealth protein CR2, conserved region 2

PFAM:	PF11380	Sequences: RFRDNDELRYSLRSIEKFAPWVRKIFIVTDGQVPDWLNTDHPKIRIVDHKDIFPDEYVLPTFNSHAIESNLHRIPGLSEHFLYFNDDMFLGRPVKPEDFFTPNGLPK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (103)
Sequences:	5301 (3935)
Seq/√Len:	387.7
META:	0.841

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_K	45_R	4.750	1.00
26_F	45_R	3.234	1.00
84_F	90_L	2.928	1.00
19_A	90_L	2.887	1.00
53_F	57_Y	2.789	1.00
18_F	93_P	2.156	1.00
11_S	15_I	2.105	1.00
68_E	85_N	2.073	1.00
28_V	52_I	1.939	1.00
31_G	48_D	1.928	1.00
95_K	98_D	1.897	1.00
31_G	50_K	1.749	1.00
29_T	48_D	1.656	1.00
12_L	27_I	1.591	1.00
53_F	66_A	1.585	1.00
33_V	46_I	1.566	1.00
54_P	70_N	1.529	1.00
12_L	16_E	1.482	1.00
71_L	83_Y	1.466	1.00
61_T	66_A	1.450	1.00
15_I	22_V	1.436	1.00
70_N	73_R	1.431	1.00
53_F	70_N	1.416	1.00
26_F	78_S	1.407	1.00
101_T	104_G	1.400	1.00
33_V	39_T	1.368	1.00
28_V	71_L	1.362	1.00
94_V	98_D	1.346	1.00
9_R	13_R	1.333	1.00
94_V	99_F	1.295	1.00
68_E	83_Y	1.294	1.00
30_D	48_D	1.293	1.00
23_R	78_S	1.287	1.00
14_S	91_G	1.284	1.00
19_A	94_V	1.242	1.00
22_V	82_L	1.226	1.00
90_L	94_V	1.226	1.00
74_I	77_L	1.191	1.00
30_D	46_I	1.177	1.00
16_E	43_K	1.176	1.00
48_D	51_D	1.174	1.00
63_N	66_A	1.147	1.00
6_D	9_R	1.125	1.00
8_L	27_I	1.104	1.00
19_A	82_L	1.103	1.00
45_R	76_G	1.086	1.00
9_R	36_W	1.070	1.00
15_I	84_F	1.047	1.00
66_A	70_N	1.036	1.00
32_Q	48_D	1.034	1.00
7_E	11_S	1.027	1.00
30_D	50_K	1.005	1.00
45_R	51_D	0.994	1.00
12_L	25_I	0.990	1.00
11_S	14_S	0.981	1.00
57_Y	70_N	0.980	1.00
27_I	44_I	0.977	1.00
98_D	101_T	0.963	1.00
84_F	88_M	0.963	1.00
54_P	73_R	0.955	1.00
14_S	18_F	0.945	1.00
54_P	57_Y	0.932	1.00
56_E	70_N	0.931	1.00
26_F	47_V	0.920	1.00
11_S	84_F	0.912	1.00
51_D	75_P	0.905	1.00
38_N	41_H	0.889	1.00
77_L	81_F	0.886	1.00
26_F	76_G	0.883	1.00
66_A	69_S	0.876	1.00
49_H	67_I	0.869	1.00
14_S	90_L	0.851	1.00
29_T	32_Q	0.843	1.00
97_E	101_T	0.841	1.00
22_V	84_F	0.824	1.00
18_F	91_G	0.824	1.00
53_F	61_T	0.816	1.00
15_I	25_I	0.811	1.00
49_H	62_F	0.809	1.00
82_L	99_F	0.807	1.00
8_L	11_S	0.805	1.00
15_I	19_A	0.801	1.00
49_H	85_N	0.801	1.00
53_F	56_E	0.798	1.00
19_A	22_V	0.797	1.00
15_I	90_L	0.796	1.00
80_H	100_F	0.793	1.00
24_K	43_K	0.792	1.00
57_Y	66_A	0.772	1.00
32_Q	49_H	0.764	1.00
65_H	88_M	0.762	1.00
85_N	88_M	0.758	1.00
7_E	89_F	0.752	1.00
21_W	96_P	0.743	1.00
29_T	46_I	0.741	1.00
32_Q	46_I	0.740	1.00
39_T	42_P	0.739	1.00
23_R	26_F	0.738	1.00
8_L	36_W	0.736	1.00
79_E	100_F	0.716	1.00
65_H	68_E	0.703	1.00
25_I	41_H	0.695	0.99
36_W	40_D	0.690	0.99
39_T	46_I	0.682	0.99
10_Y	13_R	0.677	0.99
97_E	102_P	0.672	0.99
22_V	25_I	0.666	0.99
64_S	83_Y	0.666	0.99
28_V	47_V	0.656	0.99
6_D	35_D	0.656	0.99
10_Y	14_S	0.650	0.99
65_H	69_S	0.638	0.99
53_F	59_L	0.635	0.99
8_L	12_L	0.634	0.99
21_W	94_V	0.632	0.99
31_G	46_I	0.629	0.99
49_H	59_L	0.614	0.99
64_S	68_E	0.598	0.98
47_V	74_I	0.596	0.98
32_Q	62_F	0.596	0.98
30_D	49_H	0.592	0.98
2_F	49_H	0.590	0.98
26_F	74_I	0.588	0.98
80_H	104_G	0.587	0.98
49_H	88_M	0.586	0.98
80_H	96_P	0.584	0.98
26_F	52_I	0.576	0.98
13_R	36_W	0.573	0.98
98_D	102_P	0.572	0.98
60_P	63_N	0.570	0.98
37_L	41_H	0.562	0.98
61_T	65_H	0.556	0.98
49_H	52_I	0.555	0.98
33_V	48_D	0.555	0.98
13_R	16_E	0.545	0.97
27_I	46_I	0.545	0.97
28_V	74_I	0.541	0.97
27_I	37_L	0.541	0.97
4_D	8_L	0.539	0.97
33_V	38_N	0.537	0.97
65_H	83_Y	0.535	0.97
7_E	27_I	0.533	0.97
21_W	99_F	0.531	0.97
61_T	67_I	0.529	0.97
71_L	81_F	0.529	0.97
10_Y	36_W	0.529	0.97
8_L	13_R	0.527	0.97
13_R	41_H	0.521	0.96
9_R	14_S	0.519	0.96
7_E	12_L	0.517	0.96
21_W	95_K	0.512	0.96
9_R	35_D	0.509	0.96
52_I	70_N	0.503	0.96
33_V	36_W	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1hm9A	3	0.8972	34.8	0.897	Contact Map
2ggoA	3	0.8692	25.5	0.904	Contact Map
2qh5A	1	0.8879	19	0.909	Contact Map
4fixA	3	0.9252	16.2	0.912	Contact Map
4fceA	3	0.8318	15.5	0.913	Contact Map
4g3qA	3	0.9065	15	0.913	Contact Map
4mndA	2	0.8692	14.3	0.914	Contact Map
2e3dA	3	0.8879	13.8	0.915	Contact Map
2v0hA	3	0.8879	13.7	0.915	Contact Map
4aylA	1	0.9439	12.2	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.