DUF3176 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3176 - Protein of unknown function (DUF3176)

PFAM:	PF11374	Sequences: VAVLAVYDGKPLPDWPLGITLNALISILSTIAKAALLVPVAEGLSQLKWLWFSRRGRPLSDLERFDEASRGPWGSLKLLWRLRGRNLAALGALITILALAFDPFLQQAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	109 (108)
Sequences:	865 (758)
Seq/√Len:	72.9
META:	0.424

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_K	102_D	4.439	1.00
2_A	6_V	4.041	1.00
48_K	66_D	3.664	1.00
13_P	51_W	3.014	1.00
66_D	70_R	2.932	1.00
13_P	18_G	2.652	1.00
37_L	95_T	2.263	1.00
7_Y	21_L	2.249	1.00
19_I	23_A	2.168	1.00
51_W	65_F	1.965	1.00
29_S	105_L	1.887	1.00
66_D	69_S	1.873	1.00
19_I	43_G	1.794	1.00
37_L	98_A	1.738	1.00
45_S	69_S	1.728	1.00
68_A	74_G	1.681	1.00
71_G	74_G	1.674	1.00
24_L	28_L	1.664	1.00
104_F	107_Q	1.630	0.99
20_T	23_A	1.598	0.99
57_R	61_D	1.569	0.99
23_A	107_Q	1.530	0.99
52_F	62_L	1.489	0.99
64_R	81_R	1.463	0.99
32_A	36_L	1.384	0.98
25_I	105_L	1.383	0.98
29_S	93_L	1.362	0.98
26_S	103_P	1.361	0.98
101_F	104_F	1.344	0.98
97_L	104_F	1.300	0.97
7_Y	13_P	1.291	0.97
29_S	108_A	1.269	0.97
26_S	30_T	1.256	0.97
8_D	21_L	1.208	0.96
2_A	5_A	1.181	0.96
21_L	51_W	1.175	0.95
70_R	74_G	1.172	0.95
67_E	77_K	1.171	0.95
74_G	79_L	1.169	0.95
83_R	89_A	1.166	0.95
60_S	64_R	1.160	0.95
27_I	100_A	1.146	0.95
37_L	40_V	1.097	0.93
65_F	78_L	1.078	0.93
86_N	91_G	1.073	0.93
102_D	108_A	1.071	0.93
26_S	34_A	1.050	0.92
13_P	16_P	1.040	0.91
38_V	64_R	1.035	0.91
21_L	63_E	1.033	0.91
24_L	54_R	1.031	0.91
10_K	55_R	1.027	0.91
15_W	24_L	1.022	0.91
17_L	75_S	0.997	0.90
52_F	63_E	0.995	0.90
35_A	38_V	0.994	0.89
29_S	101_F	0.992	0.89
37_L	105_L	0.975	0.89
1_V	6_V	0.973	0.88
43_G	98_A	0.967	0.88
38_V	42_E	0.960	0.88
39_P	42_E	0.953	0.87
23_A	80_W	0.950	0.87
85_R	90_L	0.950	0.87
51_W	85_R	0.947	0.87
1_V	15_W	0.943	0.87
44_L	95_T	0.915	0.85
34_A	37_L	0.888	0.83
15_W	26_S	0.878	0.83
26_S	33_K	0.876	0.83
51_W	61_D	0.871	0.82
51_W	57_R	0.863	0.82
86_N	89_A	0.850	0.81
39_P	43_G	0.849	0.81
56_G	93_L	0.846	0.80
73_W	77_K	0.830	0.79
3_V	60_S	0.827	0.79
45_S	74_G	0.824	0.79
3_V	24_L	0.823	0.78
67_E	100_A	0.816	0.78
45_S	48_K	0.812	0.78
10_K	14_D	0.787	0.75
101_F	107_Q	0.785	0.75
34_A	69_S	0.774	0.74
34_A	72_P	0.772	0.74
103_P	106_Q	0.769	0.74
32_A	101_F	0.766	0.73
46_Q	70_R	0.760	0.73
5_A	10_K	0.753	0.72
16_P	21_L	0.747	0.71
1_V	36_L	0.732	0.70
32_A	94_I	0.720	0.69
44_L	88_A	0.714	0.68
13_P	25_I	0.710	0.68
45_S	66_D	0.706	0.67
40_V	75_S	0.705	0.67
28_L	39_P	0.701	0.67
36_L	39_P	0.699	0.66
41_A	92_A	0.690	0.65
97_L	108_A	0.689	0.65
42_E	100_A	0.685	0.65
2_A	10_K	0.682	0.64
77_K	93_L	0.681	0.64
11_P	14_D	0.674	0.64
4_L	22_N	0.667	0.63
36_L	94_I	0.663	0.62
59_L	96_I	0.657	0.62
44_L	66_D	0.656	0.61
6_V	18_G	0.651	0.61
8_D	59_L	0.645	0.60
1_V	41_A	0.641	0.60
30_T	33_K	0.639	0.59
32_A	39_P	0.638	0.59
9_G	35_A	0.636	0.59
35_A	59_L	0.635	0.59
19_I	76_L	0.631	0.58
3_V	28_L	0.631	0.58
27_I	63_E	0.627	0.58
4_L	26_S	0.608	0.56
6_V	10_K	0.607	0.56
26_S	29_S	0.605	0.55
30_T	40_V	0.603	0.55
11_P	53_S	0.600	0.55
44_L	50_L	0.592	0.54
8_D	14_D	0.591	0.54
72_P	99_L	0.591	0.54
71_G	78_L	0.590	0.53
30_T	62_L	0.590	0.53
21_L	104_F	0.588	0.53
55_R	76_L	0.585	0.53
25_I	48_K	0.584	0.53
82_L	93_L	0.579	0.52
89_A	93_L	0.578	0.52
36_L	102_D	0.576	0.52
13_P	21_L	0.575	0.52
60_S	95_T	0.559	0.50
14_D	58_P	0.550	0.49
43_G	46_Q	0.549	0.48
14_D	83_R	0.546	0.48
51_W	88_A	0.544	0.48
27_I	36_L	0.538	0.47
62_L	91_G	0.536	0.47
45_S	100_A	0.531	0.46
27_I	103_P	0.530	0.46
41_A	105_L	0.529	0.46
10_K	73_W	0.528	0.46
78_L	83_R	0.527	0.46
5_A	17_L	0.526	0.46
18_G	76_L	0.523	0.45
68_A	75_S	0.522	0.45
26_S	59_L	0.519	0.45
55_R	79_L	0.515	0.44
71_G	85_R	0.509	0.43
79_L	90_L	0.507	0.43
41_A	69_S	0.506	0.43
8_D	13_P	0.506	0.43
91_G	94_I	0.505	0.43
25_I	33_K	0.504	0.43
5_A	8_D	0.503	0.43
38_V	61_D	0.500	0.42
12_L	17_L	0.500	0.42
18_G	27_I	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4wutA	1	0.1743	3.2	0.93	Contact Map
4uqqA	3	0.4037	3	0.931	Contact Map
4v2xA	2	0.0092	2.8	0.933	Contact Map
3w3sA	2	0.3394	2	0.937	Contact Map
4p0tA	1	0.1651	1.8	0.939	Contact Map
4ldeA	1	0.4679	1.4	0.943	Contact Map
2lrgA	1	0.3394	1.3	0.943	Contact Map
3rqwA	4	0.3028	1.3	0.943	Contact Map
2dlgA	1	0.3119	1.2	0.945	Contact Map
1rh5C	1	0.2936	1.1	0.946	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.