DUF3175 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3175 - Protein of unknown function (DUF3175)

PFAM:	PF11373	Sequences: RWSARVTETSDALDLEPGVFTLKDPKKIARSLKRSAERSRRRKSTPFRSAMSMLTFYINRAGKNLPASRRRVLERAKDELRKLFGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (86)
Sequences:	5589 (2656)
Seq/√Len:	286.4
META:	0.964

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_R	9_T	4.272	1.00
22_L	27_K	3.300	1.00
4_A	8_E	3.063	1.00
69_R	72_V	2.600	1.00
26_K	30_R	2.576	1.00
44_S	48_R	2.402	1.00
11_D	41_R	2.350	1.00
37_E	84_F	2.155	1.00
26_K	79_E	2.133	1.00
18_G	21_T	2.002	1.00
11_D	14_D	1.954	1.00
33_K	37_E	1.902	1.00
30_R	83_L	1.865	1.00
67_A	71_R	1.814	1.00
45_T	48_R	1.762	1.00
68_S	72_V	1.625	1.00
79_E	82_K	1.581	1.00
72_V	75_R	1.579	1.00
66_P	69_R	1.579	1.00
48_R	55_T	1.575	1.00
34_R	38_R	1.533	1.00
14_D	41_R	1.532	1.00
42_R	46_P	1.481	1.00
3_S	56_F	1.479	1.00
33_K	84_F	1.448	1.00
13_L	32_L	1.396	1.00
67_A	70_R	1.341	1.00
24_D	27_K	1.260	1.00
19_V	22_L	1.259	1.00
15_L	19_V	1.251	1.00
23_K	69_R	1.249	1.00
78_D	82_K	1.219	1.00
16_E	22_L	1.207	1.00
32_L	54_L	1.176	1.00
4_A	7_T	1.170	1.00
58_I	73_L	1.160	1.00
4_A	64_N	1.093	1.00
7_T	57_Y	1.088	1.00
71_R	75_R	1.065	1.00
31_S	35_S	1.065	1.00
47_F	81_R	1.046	1.00
48_R	51_M	1.027	1.00
5_R	8_E	1.021	1.00
75_R	78_D	0.979	1.00
27_K	30_R	0.970	1.00
28_I	58_I	0.935	1.00
16_E	31_S	0.922	1.00
26_K	82_K	0.920	1.00
19_V	31_S	0.915	1.00
48_R	52_S	0.914	1.00
51_M	54_L	0.910	1.00
13_L	36_A	0.896	1.00
61_A	65_L	0.893	1.00
44_S	47_F	0.856	1.00
44_S	51_M	0.856	1.00
51_M	55_T	0.853	1.00
23_K	68_S	0.826	1.00
57_Y	61_A	0.810	0.99
79_E	83_L	0.797	0.99
24_D	28_I	0.795	0.99
70_R	74_E	0.791	0.99
23_K	27_K	0.786	0.99
28_I	73_L	0.771	0.99
56_F	61_A	0.766	0.99
16_E	19_V	0.763	0.99
51_M	81_R	0.750	0.99
12_A	15_L	0.740	0.99
26_K	83_L	0.737	0.99
25_P	75_R	0.735	0.99
18_G	22_L	0.718	0.99
58_I	74_E	0.712	0.99
13_L	42_R	0.690	0.98
68_S	71_R	0.684	0.98
33_K	83_L	0.677	0.98
34_R	40_R	0.664	0.98
19_V	35_S	0.662	0.98
8_E	11_D	0.646	0.98
25_P	72_V	0.642	0.97
7_T	61_A	0.634	0.97
47_F	55_T	0.629	0.97
68_S	75_R	0.628	0.97
78_D	81_R	0.619	0.97
47_F	52_S	0.618	0.97
59_N	62_G	0.613	0.97
22_L	72_V	0.611	0.97
58_I	65_L	0.608	0.96
17_P	40_R	0.606	0.96
39_S	42_R	0.598	0.96
66_P	72_V	0.595	0.96
64_N	72_V	0.593	0.96
33_K	47_F	0.587	0.96
32_L	51_M	0.587	0.96
74_E	78_D	0.583	0.95
32_L	73_L	0.571	0.95
63_K	66_P	0.566	0.95
21_T	64_N	0.566	0.95
3_S	7_T	0.565	0.95
51_M	80_L	0.564	0.95
31_S	36_A	0.558	0.94
49_S	53_M	0.557	0.94
46_P	84_F	0.555	0.94
1_R	4_A	0.554	0.94
61_A	66_P	0.553	0.94
12_A	39_S	0.552	0.94
37_E	46_P	0.548	0.94
66_P	82_K	0.547	0.94
74_E	82_K	0.547	0.94
28_I	74_E	0.543	0.93
38_R	67_A	0.541	0.93
55_T	74_E	0.536	0.93
56_F	59_N	0.536	0.93
75_R	79_E	0.534	0.93
14_D	61_A	0.533	0.93
37_E	85_G	0.532	0.93
83_L	86_R	0.525	0.92
35_S	39_S	0.524	0.92
4_A	9_T	0.524	0.92
39_S	49_S	0.520	0.92
57_Y	64_N	0.516	0.92
49_S	52_S	0.516	0.92
16_E	38_R	0.515	0.92
50_A	80_L	0.515	0.92
17_P	21_T	0.513	0.91
25_P	79_E	0.512	0.91
39_S	43_K	0.510	0.91
10_S	39_S	0.509	0.91
58_I	61_A	0.502	0.91
47_F	51_M	0.501	0.90
13_L	56_F	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1mwwA	3	0.3721	21.1	0.91	Contact Map
2lt3A	1	0.6744	21.1	0.91	Contact Map
4kbmB	1	0.907	8.7	0.925	Contact Map
3uncA	2	0.3837	8	0.926	Contact Map
3gh1A	3	0.3953	7.7	0.926	Contact Map
3ku7A	2	0.1628	6.9	0.928	Contact Map
4r7pA	4	0.4767	6.7	0.928	Contact Map
3hrdD	1	0.407	6.7	0.928	Contact Map
1rm6C	1	0.4186	5.6	0.931	Contact Map
4ka7A	1	0.8721	5.5	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.