DUF3147 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3147 - Protein of unknown function (DUF3147)

PFAM:	PF11345	Sequences: LLLRFLFGGLVVVAAGLIADRFGPKFGGLFLAFPAIALASLTLIELEEGKKYAAEAAASDAAGAALGAIGLLVFALVVWLLLPRLGALLALLAALLAWLVVAVLLWLVRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	110 (106)
Sequences:	3165 (2463)
Seq/√Len:	239.2
META:	0.948

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_L	105_L	3.046	1.00
73_V	101_V	2.996	1.00
56_A	59_S	2.680	1.00
78_V	82_L	2.658	1.00
56_A	60_D	2.620	1.00
77_V	97_A	2.221	1.00
57_A	60_D	2.158	1.00
79_W	83_P	2.071	1.00
48_E	52_Y	2.060	1.00
55_E	58_A	1.951	1.00
61_A	64_A	1.907	1.00
11_V	38_L	1.860	1.00
55_E	59_S	1.818	1.00
86_G	90_A	1.775	1.00
74_F	78_V	1.737	1.00
9_G	12_V	1.711	1.00
71_L	75_A	1.667	1.00
67_G	71_L	1.636	1.00
99_L	103_V	1.582	1.00
15_A	27_G	1.518	1.00
42_T	46_L	1.488	1.00
49_G	52_Y	1.445	1.00
12_V	16_G	1.441	1.00
80_L	83_P	1.428	1.00
37_A	41_L	1.415	1.00
85_L	93_A	1.413	1.00
71_L	74_F	1.390	1.00
85_L	89_L	1.390	1.00
70_G	102_A	1.367	1.00
21_R	25_K	1.362	1.00
92_L	96_L	1.357	1.00
7_F	11_V	1.355	1.00
42_T	45_E	1.339	1.00
23_G	27_G	1.330	1.00
75_A	79_W	1.309	1.00
88_L	91_L	1.306	1.00
95_L	99_L	1.270	1.00
18_I	26_F	1.252	1.00
55_E	60_D	1.251	1.00
86_G	89_L	1.214	1.00
5_F	8_G	1.212	1.00
41_L	47_E	1.195	1.00
43_L	47_E	1.186	1.00
100_V	107_L	1.184	1.00
13_V	17_L	1.181	1.00
9_G	13_V	1.169	1.00
78_V	83_P	1.164	1.00
67_G	70_G	1.155	1.00
12_V	15_A	1.110	1.00
76_L	80_L	1.110	1.00
100_V	104_L	1.077	1.00
59_S	62_A	1.064	1.00
70_G	73_V	1.058	1.00
8_G	32_A	1.054	1.00
78_V	81_L	1.044	1.00
49_G	53_A	1.022	1.00
73_V	77_V	1.021	1.00
82_L	90_A	1.018	1.00
89_L	92_L	0.994	1.00
68_A	71_L	0.987	1.00
76_L	79_W	0.987	1.00
73_V	97_A	0.975	1.00
46_L	50_K	0.975	1.00
3_L	7_F	0.963	1.00
90_A	94_A	0.960	1.00
66_L	70_G	0.956	1.00
75_A	78_V	0.948	1.00
85_L	90_A	0.937	1.00
79_W	84_R	0.937	1.00
20_D	25_K	0.931	1.00
96_L	99_L	0.917	1.00
53_A	56_A	0.912	1.00
93_A	96_L	0.899	1.00
46_L	49_G	0.894	1.00
74_F	79_W	0.873	0.99
47_E	50_K	0.873	0.99
22_F	26_F	0.862	0.99
12_V	36_I	0.850	0.99
77_V	80_L	0.841	0.99
85_L	88_L	0.805	0.99
104_L	107_L	0.805	0.99
41_L	45_E	0.805	0.99
13_V	31_L	0.805	0.99
37_A	64_A	0.794	0.99
90_A	93_A	0.788	0.99
92_L	104_L	0.786	0.99
43_L	46_L	0.772	0.99
9_G	106_W	0.746	0.98
60_D	63_G	0.739	0.98
26_F	29_L	0.735	0.98
17_L	21_R	0.732	0.98
26_F	30_F	0.728	0.98
88_L	92_L	0.728	0.98
76_L	107_L	0.724	0.98
18_I	30_F	0.724	0.98
67_G	72_L	0.721	0.98
7_F	33_F	0.719	0.98
100_V	103_V	0.719	0.98
12_V	19_A	0.691	0.97
50_K	53_A	0.691	0.97
64_A	67_G	0.691	0.97
14_A	18_I	0.689	0.97
74_F	81_L	0.687	0.97
17_L	20_D	0.681	0.97
98_W	102_A	0.678	0.97
41_L	44_I	0.675	0.97
6_L	76_L	0.674	0.97
89_L	96_L	0.672	0.97
58_A	62_A	0.671	0.97
73_V	93_A	0.670	0.97
103_V	107_L	0.670	0.97
82_L	85_L	0.668	0.96
4_R	43_L	0.662	0.96
67_G	73_V	0.657	0.96
7_F	35_A	0.655	0.96
79_W	82_L	0.651	0.96
63_G	72_L	0.650	0.96
44_I	48_E	0.644	0.96
45_E	50_K	0.640	0.95
87_A	105_L	0.638	0.95
92_L	100_V	0.633	0.95
43_L	48_E	0.632	0.95
87_A	91_L	0.631	0.95
15_A	23_G	0.627	0.95
77_V	93_A	0.606	0.94
12_V	20_D	0.606	0.94
80_L	86_G	0.602	0.94
48_E	51_K	0.595	0.93
78_V	91_L	0.591	0.93
5_F	98_W	0.589	0.93
44_I	47_E	0.584	0.93
9_G	20_D	0.570	0.92
45_E	49_G	0.568	0.92
64_A	68_A	0.568	0.92
41_L	46_L	0.567	0.92
80_L	90_A	0.564	0.91
10_L	14_A	0.563	0.91
5_F	64_A	0.562	0.91
72_L	76_L	0.559	0.91
9_G	29_L	0.549	0.90
5_F	43_L	0.548	0.90
8_G	52_Y	0.545	0.90
7_F	38_L	0.537	0.89
48_E	53_A	0.532	0.89
69_I	73_V	0.529	0.89
20_D	24_P	0.525	0.88
25_K	107_L	0.524	0.88
61_A	70_G	0.523	0.88
76_L	81_L	0.522	0.88
25_K	95_L	0.520	0.88
56_A	100_V	0.514	0.87
14_A	17_L	0.510	0.87
86_G	92_L	0.509	0.87
2_L	51_K	0.508	0.87
63_G	67_G	0.508	0.87
31_L	37_A	0.506	0.86
16_G	24_P	0.505	0.86
4_R	36_I	0.505	0.86
97_A	102_A	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rceA	1	0.9	28.6	0.859	Contact Map
3wajA	1	0.9182	5.6	0.898	Contact Map
3klyA	3	0.7182	4.3	0.904	Contact Map
4i0uA	4	0.7091	4	0.905	Contact Map
4ev6A	3	0.7273	3	0.911	Contact Map
1iijA	1	0.3182	2.8	0.912	Contact Map
3kcuA	3	0.7273	2	0.919	Contact Map
3zuxA	1	0.9727	1.9	0.919	Contact Map
4n7wA	2	0.9727	1.4	0.926	Contact Map
3w4tA	1	0.9273	1.1	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.