DUF3145 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3145 - Protein of unknown function (DUF3145)

PFAM:	PF11343	Sequences: VLYVHSAPRALCPHVEWAVAGVLGVPVSLDWTPQPAAPGTLRAELSWQGPPGTGARLASALRGWPHLRFEVTEEPSPGVDGERYSHTPDLGIFHAVTGANGDIVVPEDRLRAALARAAGGAEELAHELDRLLGTAWDDELEPFRHAGDGAPVRWLHQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	157 (157)
Sequences:	1689 (777)
Seq/√Len:	62.0
META:	0.775

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_E	94_H	5.287	1.00
110_L	128_L	4.580	1.00
98_G	102_D	3.597	1.00
76_S	79_V	3.555	1.00
2_L	19_V	3.418	1.00
96_V	104_V	3.157	1.00
129_D	134_T	2.976	1.00
134_T	138_D	2.773	1.00
114_L	128_L	2.720	1.00
16_E	20_A	2.476	1.00
19_V	29_L	2.323	1.00
7_A	15_V	2.263	1.00
52_G	73_E	2.246	1.00
114_L	124_L	2.206	1.00
124_L	128_L	2.129	1.00
54_G	84_Y	2.124	1.00
75_P	81_G	1.980	1.00
95_A	103_I	1.915	1.00
6_S	68_R	1.908	1.00
112_A	116_R	1.894	1.00
127_E	130_R	1.825	1.00
87_T	90_L	1.781	1.00
80_D	100_N	1.740	0.99
120_G	123_E	1.691	0.99
29_L	43_A	1.632	0.99
68_R	139_E	1.618	0.99
13_P	18_A	1.588	0.99
98_G	104_V	1.582	0.99
113_A	127_E	1.574	0.99
38_P	41_L	1.557	0.99
15_V	67_L	1.555	0.99
29_L	45_L	1.554	0.99
105_V	110_L	1.529	0.98
9_R	21_G	1.512	0.98
80_D	99_A	1.455	0.98
123_E	126_H	1.429	0.98
93_F	103_I	1.424	0.98
8_P	11_L	1.393	0.97
105_V	131_L	1.382	0.97
69_F	86_H	1.361	0.97
54_G	69_F	1.344	0.97
1_V	15_V	1.344	0.97
5_H	42_R	1.344	0.97
14_H	17_W	1.306	0.96
80_D	98_G	1.299	0.96
120_G	125_A	1.281	0.95
152_V	156_H	1.276	0.95
37_A	40_T	1.270	0.95
125_A	129_D	1.257	0.95
85_S	93_F	1.244	0.95
24_G	27_V	1.238	0.95
97_T	104_V	1.198	0.94
51_P	76_S	1.186	0.93
149_G	153_R	1.180	0.93
51_P	79_V	1.157	0.92
116_R	127_E	1.152	0.92
113_A	124_L	1.141	0.92
54_G	82_E	1.134	0.92
68_R	72_T	1.125	0.91
58_A	92_I	1.086	0.90
84_Y	92_I	1.081	0.89
5_H	10_A	1.078	0.89
87_T	139_E	1.069	0.89
50_P	56_R	1.063	0.89
40_T	85_S	1.061	0.89
85_S	97_T	1.057	0.88
141_E	144_R	1.057	0.88
68_R	74_E	1.053	0.88
4_V	7_A	1.049	0.88
84_Y	94_H	1.047	0.88
111_R	115_A	1.038	0.87
7_A	94_H	1.023	0.87
113_A	131_L	1.021	0.87
7_A	12_C	1.016	0.86
114_L	125_A	0.998	0.85
9_R	41_L	0.990	0.85
51_P	78_G	0.988	0.85
112_A	115_A	0.961	0.83
111_R	119_G	0.957	0.83
3_Y	9_R	0.955	0.83
9_R	13_P	0.954	0.83
76_S	80_D	0.949	0.82
55_A	84_Y	0.937	0.81
114_L	117_A	0.931	0.81
94_H	97_T	0.925	0.81
55_A	70_E	0.923	0.80
84_Y	90_L	0.910	0.80
31_W	34_Q	0.906	0.79
9_R	36_A	0.903	0.79
96_V	103_I	0.899	0.79
36_A	150_A	0.898	0.79
121_A	125_A	0.891	0.78
137_D	141_E	0.889	0.78
83_R	111_R	0.889	0.78
33_P	41_L	0.889	0.78
84_Y	87_T	0.886	0.78
54_G	57_L	0.884	0.78
72_T	83_R	0.883	0.77
82_E	96_V	0.862	0.76
37_A	66_H	0.850	0.75
58_A	71_V	0.844	0.74
14_H	18_A	0.839	0.74
89_D	139_E	0.832	0.73
106_P	109_R	0.831	0.73
42_R	72_T	0.830	0.73
119_G	125_A	0.825	0.72
74_E	81_G	0.820	0.72
2_L	54_G	0.818	0.72
114_L	129_D	0.817	0.72
12_C	41_L	0.815	0.72
96_V	106_P	0.803	0.70
74_E	83_R	0.798	0.70
27_V	30_D	0.792	0.69
147_G	151_P	0.791	0.69
140_L	144_R	0.789	0.69
97_T	103_I	0.784	0.69
54_G	86_H	0.771	0.67
80_D	104_V	0.770	0.67
5_H	17_W	0.770	0.67
131_L	157_Q	0.768	0.67
136_W	144_R	0.756	0.66
119_G	123_E	0.753	0.65
67_L	116_R	0.751	0.65
38_P	58_A	0.751	0.65
22_V	27_V	0.748	0.65
139_E	143_F	0.743	0.64
22_V	57_L	0.742	0.64
57_L	65_P	0.736	0.64
9_R	86_H	0.736	0.64
123_E	129_D	0.736	0.64
97_T	154_W	0.735	0.64
21_G	26_P	0.722	0.62
133_G	136_W	0.721	0.62
19_V	124_L	0.712	0.61
111_R	121_A	0.712	0.61
50_P	114_L	0.711	0.61
21_G	25_V	0.711	0.61
77_P	115_A	0.699	0.60
76_S	99_A	0.698	0.60
36_A	39_G	0.693	0.59
23_L	62_R	0.691	0.59
11_L	14_H	0.688	0.58
55_A	58_A	0.685	0.58
61_L	72_T	0.683	0.58
65_P	69_F	0.679	0.57
15_V	38_P	0.676	0.57
112_A	127_E	0.674	0.57
99_A	157_Q	0.670	0.56
122_E	126_H	0.666	0.56
102_D	131_L	0.664	0.56
124_L	130_R	0.661	0.55
37_A	143_F	0.657	0.55
59_S	106_P	0.653	0.55
124_L	134_T	0.650	0.54
84_Y	98_G	0.648	0.54
10_A	17_W	0.648	0.54
52_G	55_A	0.639	0.53
96_V	114_L	0.635	0.53
7_A	63_G	0.631	0.52
7_A	20_A	0.630	0.52
40_T	66_H	0.626	0.52
80_D	86_H	0.620	0.51
130_R	135_A	0.619	0.51
118_A	129_D	0.618	0.51
38_P	99_A	0.615	0.50
26_P	69_F	0.615	0.50
33_P	39_G	0.614	0.50
3_Y	81_G	0.613	0.50
2_L	20_A	0.612	0.50
58_A	104_V	0.609	0.50
73_E	76_S	0.609	0.50
66_H	87_T	0.608	0.49
32_T	43_A	0.603	0.49
45_L	71_V	0.602	0.49
56_R	82_E	0.602	0.49
59_S	113_A	0.597	0.48
113_A	138_D	0.593	0.48
8_P	75_P	0.590	0.47
4_V	12_C	0.590	0.47
153_R	156_H	0.589	0.47
79_V	99_A	0.586	0.47
41_L	55_A	0.585	0.47
146_A	153_R	0.582	0.46
20_A	27_V	0.582	0.46
58_A	69_F	0.582	0.46
103_I	108_D	0.576	0.46
145_H	150_A	0.575	0.46
102_D	115_A	0.568	0.45
49_G	52_G	0.564	0.44
46_S	99_A	0.562	0.44
64_W	67_L	0.562	0.44
10_A	14_H	0.560	0.44
40_T	45_L	0.558	0.44
7_A	11_L	0.556	0.44
90_L	136_W	0.554	0.43
2_L	48_Q	0.552	0.43
62_R	66_H	0.546	0.42
44_E	146_A	0.544	0.42
12_C	112_A	0.544	0.42
75_P	78_G	0.543	0.42
107_E	137_D	0.543	0.42
46_S	81_G	0.542	0.42
27_V	67_L	0.541	0.42
154_W	157_Q	0.541	0.42
98_G	120_G	0.541	0.42
28_S	45_L	0.541	0.42
62_R	65_P	0.540	0.42
96_V	109_R	0.538	0.42
108_D	112_A	0.538	0.42
10_A	16_E	0.537	0.41
86_H	131_L	0.532	0.41
67_L	138_D	0.527	0.40
1_V	119_G	0.524	0.40
97_T	124_L	0.523	0.40
134_T	146_A	0.523	0.40
93_F	97_T	0.523	0.40
92_I	98_G	0.521	0.40
68_R	143_F	0.520	0.40
73_E	78_G	0.520	0.40
7_A	97_T	0.520	0.40
119_G	122_E	0.518	0.39
3_Y	12_C	0.517	0.39
148_D	156_H	0.517	0.39
67_L	128_L	0.515	0.39
110_L	130_R	0.513	0.39
21_G	37_A	0.513	0.39
105_V	135_A	0.512	0.39
47_W	54_G	0.510	0.38
11_L	65_P	0.508	0.38
10_A	72_T	0.506	0.38
105_V	111_R	0.506	0.38
136_W	141_E	0.504	0.38
65_P	89_D	0.503	0.38
87_T	153_R	0.502	0.38
102_D	110_L	0.502	0.38
47_W	137_D	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l1wB	1	0.1592	10.6	0.958	Contact Map
2m7eA	1	0.1656	8.7	0.96	Contact Map
2ejaA	2	0.6815	7.9	0.96	Contact Map
3jszA	1	0.5223	7.5	0.961	Contact Map
3u0rA	1	0.121	7.2	0.961	Contact Map
1whzA	1	0.4459	6.7	0.962	Contact Map
4qqwA	2	0.535	6.1	0.963	Contact Map
2elcA	4	0.9618	4.5	0.965	Contact Map
3p8aA	1	0.4841	4.4	0.965	Contact Map
3fegA	2	0.2102	4.4	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.