DUF3038 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3038 - Protein of unknown function (DUF3038)

PFAM:	PF11237	Sequences: PRRIKEQLDLLLLALEALDLNGSEAMLAAANELGLNDVIPNRVTLWRLRCSNPLRKSYGRKKLDLEEADALVLITCELAKRLYPLIRQLLSSLEQLEEKQLPPENSARLGDYLDRFRELIRERMNPRRSRVKKLLSPEELDELALKLLLDLLFCSGTGGYQRLWLSLFD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	169 (168)
Sequences:	565 (299)
Seq/√Len:	23.1
META:	0.692

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_L	163_L	4.351	1.00
31_N	36_N	2.847	0.99
162_R	167_L	2.734	0.99
85_L	108_R	2.687	0.99
37_D	79_A	2.515	0.98
24_E	42_R	2.319	0.97
18_L	167_L	2.295	0.97
52_N	58_Y	2.286	0.97
49_R	123_R	2.256	0.97
69_D	164_W	2.228	0.97
8_L	72_V	2.197	0.96
49_R	55_R	2.132	0.96
55_R	123_R	2.101	0.95
24_E	79_A	2.024	0.94
51_S	61_K	1.978	0.93
87_R	112_Y	1.942	0.93
6_E	50_C	1.940	0.93
75_T	99_K	1.894	0.92
157_T	162_R	1.878	0.91
94_E	98_E	1.865	0.91
53_P	123_R	1.863	0.91
52_N	57_S	1.845	0.91
88_Q	92_S	1.835	0.90
46_W	55_R	1.829	0.90
67_E	143_L	1.821	0.90
140_L	144_A	1.766	0.88
52_N	55_R	1.738	0.88
46_W	49_R	1.699	0.86
84_P	88_Q	1.669	0.85
46_W	123_R	1.654	0.85
2_R	6_E	1.639	0.84
25_A	78_L	1.582	0.82
19_D	78_L	1.543	0.80
45_L	61_K	1.534	0.80
92_S	107_A	1.529	0.80
38_V	70_A	1.522	0.80
112_Y	148_L	1.496	0.78
41_N	44_T	1.477	0.77
55_R	124_M	1.475	0.77
16_E	49_R	1.459	0.77
41_N	47_R	1.448	0.76
2_R	19_D	1.427	0.75
140_L	143_L	1.415	0.74
133_K	163_L	1.411	0.74
150_D	154_C	1.400	0.73
61_K	67_E	1.390	0.73
88_Q	108_R	1.381	0.72
92_S	108_R	1.369	0.72
43_V	74_I	1.365	0.72
159_G	162_R	1.315	0.69
160_Y	163_L	1.308	0.68
98_E	102_P	1.306	0.68
14_A	35_L	1.301	0.68
16_E	55_R	1.297	0.67
49_R	52_N	1.291	0.67
14_A	87_R	1.287	0.67
60_R	123_R	1.235	0.64
42_R	60_R	1.223	0.63
30_A	149_L	1.214	0.62
8_L	94_E	1.206	0.62
14_A	112_Y	1.206	0.62
14_A	168_F	1.204	0.62
58_Y	78_L	1.182	0.60
9_D	12_L	1.181	0.60
92_S	106_S	1.180	0.60
16_E	46_W	1.170	0.59
52_N	128_R	1.166	0.59
9_D	159_G	1.165	0.59
109_L	120_I	1.151	0.58
36_N	149_L	1.135	0.57
52_N	125_N	1.127	0.56
8_L	35_L	1.107	0.55
101_L	107_A	1.103	0.55
52_N	119_L	1.095	0.54
40_P	44_T	1.092	0.54
18_L	162_R	1.091	0.54
103_P	163_L	1.091	0.54
18_L	86_I	1.090	0.54
114_D	121_R	1.088	0.54
22_G	25_A	1.082	0.53
43_V	123_R	1.080	0.53
52_N	123_R	1.075	0.53
58_Y	130_R	1.062	0.52
125_N	128_R	1.048	0.51
102_P	105_N	1.045	0.51
82_L	154_C	1.032	0.50
11_L	150_D	1.026	0.49
92_S	101_L	1.017	0.49
152_L	164_W	1.008	0.48
14_A	33_L	1.004	0.48
84_P	92_S	0.994	0.47
12_L	22_G	0.990	0.47
84_P	108_R	0.987	0.47
115_R	156_G	0.986	0.47
16_E	27_L	0.980	0.46
94_E	135_L	0.969	0.45
143_L	153_F	0.957	0.45
112_Y	144_A	0.956	0.45
32_E	40_P	0.952	0.44
45_L	60_R	0.951	0.44
51_S	126_P	0.951	0.44
74_I	105_N	0.924	0.42
98_E	158_G	0.923	0.42
29_A	77_E	0.920	0.42
22_G	30_A	0.906	0.41
35_L	117_R	0.901	0.41
101_L	105_N	0.899	0.41
116_F	144_A	0.895	0.40
5_K	59_G	0.883	0.40
38_V	74_I	0.877	0.39
17_A	25_A	0.874	0.39
42_R	124_M	0.873	0.39
151_L	159_G	0.872	0.39
120_I	143_L	0.870	0.39
67_E	74_I	0.870	0.39
11_L	75_T	0.868	0.39
85_L	94_E	0.861	0.38
129_S	157_T	0.856	0.38
7_Q	43_V	0.854	0.38
11_L	151_L	0.848	0.37
115_R	119_L	0.847	0.37
53_P	124_M	0.841	0.37
34_G	38_V	0.839	0.37
74_I	93_L	0.837	0.37
6_E	54_L	0.837	0.37
84_P	100_Q	0.833	0.36
6_E	78_L	0.829	0.36
158_G	165_L	0.823	0.36
96_L	106_S	0.819	0.35
75_T	132_K	0.819	0.35
93_L	97_E	0.817	0.35
76_C	86_I	0.817	0.35
69_D	168_F	0.812	0.35
4_I	61_K	0.803	0.34
63_L	102_P	0.799	0.34
23_S	27_L	0.798	0.34
28_A	102_P	0.787	0.33
114_D	161_Q	0.782	0.33
14_A	116_F	0.772	0.32
43_V	71_L	0.768	0.32
47_R	152_L	0.766	0.32
112_Y	116_F	0.762	0.32
9_D	16_E	0.761	0.32
70_A	88_Q	0.759	0.32
11_L	74_I	0.759	0.32
5_K	67_E	0.758	0.32
10_L	102_P	0.756	0.32
70_A	92_S	0.754	0.31
114_D	133_K	0.752	0.31
136_S	139_E	0.746	0.31
116_F	155_S	0.740	0.31
100_Q	136_S	0.735	0.30
9_D	13_L	0.724	0.30
83_Y	91_S	0.720	0.29
27_L	42_R	0.720	0.29
2_R	115_R	0.719	0.29
4_I	79_A	0.711	0.29
85_L	88_Q	0.707	0.29
148_L	168_F	0.706	0.29
82_L	115_R	0.700	0.28
153_F	164_W	0.695	0.28
66_E	169_D	0.695	0.28
110_G	141_D	0.695	0.28
56_K	119_L	0.694	0.28
86_I	97_E	0.689	0.28
29_A	73_L	0.686	0.27
13_L	17_A	0.680	0.27
95_Q	109_L	0.680	0.27
9_D	123_R	0.677	0.27
116_F	152_L	0.677	0.27
52_N	156_G	0.676	0.27
115_R	125_N	0.672	0.27
65_L	86_I	0.671	0.27
16_E	43_V	0.670	0.27
28_A	32_E	0.669	0.27
148_L	151_L	0.666	0.26
107_A	158_G	0.666	0.26
40_P	156_G	0.664	0.26
104_E	141_D	0.664	0.26
51_S	59_G	0.663	0.26
159_G	163_L	0.661	0.26
30_A	114_D	0.659	0.26
62_K	132_K	0.657	0.26
119_L	122_E	0.653	0.26
96_L	169_D	0.652	0.26
88_Q	95_Q	0.650	0.26
164_W	168_F	0.631	0.25
5_K	64_D	0.631	0.25
113_L	144_A	0.628	0.24
73_L	94_E	0.627	0.24
69_D	120_I	0.624	0.24
66_E	81_R	0.623	0.24
13_L	16_E	0.623	0.24
76_C	81_R	0.622	0.24
14_A	78_L	0.618	0.24
71_L	87_R	0.614	0.24
5_K	54_L	0.612	0.24
47_R	63_L	0.609	0.23
21_N	26_M	0.604	0.23
19_D	59_G	0.602	0.23
19_D	25_A	0.602	0.23
59_G	130_R	0.601	0.23
17_A	56_K	0.596	0.23
18_L	117_R	0.593	0.23
144_A	152_L	0.592	0.23
22_G	55_R	0.591	0.23
31_N	121_R	0.590	0.22
12_L	45_L	0.590	0.22
15_L	23_S	0.589	0.22
109_L	112_Y	0.587	0.22
55_R	60_R	0.579	0.22
54_L	94_E	0.578	0.22
28_A	103_P	0.576	0.22
80_K	119_L	0.568	0.21
48_L	129_S	0.564	0.21
18_L	27_L	0.560	0.21
139_E	142_E	0.555	0.21
45_L	68_A	0.554	0.21
13_L	81_R	0.552	0.21
43_V	46_W	0.547	0.20
125_N	162_R	0.546	0.20
100_Q	135_L	0.544	0.20
65_L	164_W	0.544	0.20
91_S	145_L	0.541	0.20
68_A	104_E	0.538	0.20
15_L	151_L	0.532	0.20
23_S	45_L	0.531	0.20
62_K	135_L	0.531	0.20
115_R	168_F	0.530	0.20
52_N	115_R	0.529	0.20
114_D	132_K	0.527	0.20
5_K	78_L	0.527	0.20
9_D	53_P	0.525	0.19
8_L	75_T	0.525	0.19
32_E	44_T	0.521	0.19
78_L	93_L	0.520	0.19
85_L	92_S	0.520	0.19
86_I	91_S	0.519	0.19
42_R	45_L	0.517	0.19
13_L	119_L	0.517	0.19
16_E	52_N	0.515	0.19
56_K	73_L	0.514	0.19
76_C	130_R	0.511	0.19
145_L	154_C	0.510	0.19
95_Q	143_L	0.509	0.19
42_R	79_A	0.509	0.19
101_L	106_S	0.508	0.19
34_G	165_L	0.503	0.19
28_A	97_E	0.502	0.18
76_C	169_D	0.501	0.18
27_L	60_R	0.500	0.18
34_G	142_E	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4yczB	1	0.8462	25.5	0.949	Contact Map
4xmmD	1	0.7396	16.1	0.954	Contact Map
1hlvA	1	0.6805	8.1	0.959	Contact Map
3m3wA	2	0.3432	5.1	0.963	Contact Map
4dylA	2	0.3905	4.2	0.964	Contact Map
1fmeA	1	0.1538	4	0.965	Contact Map
3oaoA	2	0.5917	3.9	0.965	Contact Map
1ubyA	2	0.355	3.7	0.966	Contact Map
2cobA	1	0.3491	3.5	0.966	Contact Map
5a29A	2	0.3373	3.4	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.