DUF3027 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF3027 - Protein of unknown function (DUF3027)

PFAM:	PF11228	Sequences: GEHLGVVAEGERVVTHLFACTLPGYRGWRWAVTVARAPRAKTVTVDEVVLLPGPDALLAPEWVPWSERLRPGDLGPGDLLPTAADDPRLVPGYTATDDPAVVREVAWELGLGRARVLSREGRDEAAERWYDGDHGPDSPMARAAPAPCGTCGFLVPLAGSLGQAFGVCANEYSPDDGRVVSLDHGCGAHSEAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	193 (192)
Sequences:	1780 (888)
Seq/√Len:	64.1
META:	0.696

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
154_L	182_L	4.358	1.00
175_D	184_H	4.054	1.00
17_L	29_R	3.751	1.00
13_V	46_D	3.367	1.00
114_A	191_E	3.362	1.00
6_V	14_V	3.048	1.00
12_R	39_R	3.016	1.00
127_E	131_D	2.980	1.00
15_T	31_A	2.927	1.00
134_H	178_R	2.895	1.00
89_L	152_G	2.880	1.00
36_R	39_R	2.722	1.00
134_H	175_D	2.613	1.00
12_R	41_K	2.437	1.00
75_G	78_D	2.392	1.00
88_R	153_F	2.370	1.00
138_S	141_A	2.346	1.00
155_V	169_A	2.333	1.00
37_A	40_A	2.284	1.00
79_L	145_P	2.279	1.00
117_L	169_A	2.265	1.00
4_L	19_A	2.260	1.00
12_R	36_R	2.211	1.00
8_A	14_V	2.208	1.00
36_R	41_K	2.143	1.00
134_H	184_H	2.068	1.00
34_V	43_V	2.067	1.00
3_H	16_H	1.883	1.00
2_E	19_A	1.860	1.00
35_A	46_D	1.858	1.00
145_P	192_A	1.813	1.00
87_P	120_E	1.768	1.00
3_H	6_V	1.712	0.99
82_T	172_Y	1.568	0.99
99_P	103_R	1.547	0.99
38_P	41_K	1.512	0.99
102_V	105_V	1.496	0.98
96_T	102_V	1.490	0.98
154_L	167_V	1.464	0.98
75_G	174_P	1.458	0.98
137_D	142_R	1.445	0.98
76_P	174_P	1.432	0.98
140_M	175_D	1.423	0.98
93_Y	96_T	1.421	0.98
139_P	143_A	1.415	0.98
175_D	183_D	1.400	0.98
26_R	55_D	1.385	0.97
118_S	121_G	1.368	0.97
96_T	100_A	1.360	0.97
130_Y	183_D	1.352	0.97
80_L	172_Y	1.342	0.97
92_G	116_V	1.320	0.97
140_M	184_H	1.318	0.97
87_P	153_F	1.301	0.96
40_A	43_V	1.300	0.96
125_A	169_A	1.294	0.96
134_H	177_G	1.264	0.96
155_V	161_L	1.248	0.95
96_T	103_R	1.245	0.95
82_T	192_A	1.234	0.95
125_A	152_G	1.229	0.95
20_C	24_G	1.226	0.95
175_D	178_R	1.213	0.94
126_A	161_L	1.206	0.94
181_S	184_H	1.200	0.94
139_P	142_R	1.189	0.94
146_A	150_T	1.185	0.94
91_P	94_T	1.171	0.93
187_G	190_S	1.169	0.93
13_V	35_A	1.167	0.93
157_L	167_V	1.160	0.93
7_V	29_R	1.159	0.93
102_V	106_A	1.128	0.92
130_Y	184_H	1.119	0.92
186_C	189_H	1.103	0.91
130_Y	181_S	1.102	0.91
132_G	138_S	1.096	0.91
164_A	183_D	1.095	0.91
77_G	145_P	1.079	0.90
39_R	42_T	1.077	0.90
134_H	181_S	1.055	0.89
72_G	188_A	1.031	0.88
93_Y	112_G	1.028	0.88
9_E	15_T	1.020	0.87
14_V	34_V	1.017	0.87
17_L	31_A	1.017	0.87
20_C	50_L	1.015	0.87
48_V	143_A	0.991	0.86
123_D	126_A	0.975	0.85
47_E	172_Y	0.965	0.84
186_C	190_S	0.960	0.84
108_E	112_G	0.954	0.84
158_A	162_G	0.952	0.84
37_A	43_V	0.948	0.83
74_L	188_A	0.948	0.83
90_V	116_V	0.948	0.83
120_E	123_D	0.936	0.83
76_P	87_P	0.933	0.82
69_L	80_L	0.932	0.82
76_P	140_M	0.921	0.81
13_V	36_R	0.908	0.81
119_R	123_D	0.896	0.80
10_G	13_V	0.894	0.80
101_V	104_E	0.892	0.79
130_Y	136_P	0.891	0.79
29_R	54_P	0.889	0.79
76_P	143_A	0.889	0.79
132_G	136_P	0.888	0.79
17_L	56_A	0.887	0.79
16_H	43_V	0.870	0.78
115_R	191_E	0.868	0.77
92_G	111_L	0.865	0.77
65_W	93_Y	0.862	0.77
107_W	110_G	0.862	0.77
31_A	51_L	0.861	0.77
76_P	82_T	0.860	0.77
130_Y	175_D	0.856	0.76
12_R	38_P	0.848	0.76
20_C	48_V	0.847	0.76
147_P	150_T	0.847	0.76
69_L	78_D	0.842	0.75
97_D	103_R	0.839	0.75
93_Y	110_G	0.827	0.74
117_L	121_G	0.823	0.74
16_H	36_R	0.820	0.73
97_D	105_V	0.817	0.73
24_G	119_R	0.801	0.72
124_E	171_E	0.801	0.72
29_R	33_T	0.796	0.71
134_H	138_S	0.796	0.71
107_W	163_Q	0.793	0.71
17_L	23_P	0.791	0.71
31_A	49_V	0.791	0.71
82_T	88_R	0.790	0.71
5_G	29_R	0.783	0.70
116_V	119_R	0.783	0.70
79_L	127_E	0.769	0.68
77_G	140_M	0.766	0.68
61_E	67_E	0.757	0.67
117_L	125_A	0.752	0.67
15_T	53_G	0.742	0.66
185_G	189_H	0.741	0.66
76_P	120_E	0.739	0.65
31_A	173_S	0.733	0.65
92_G	95_A	0.732	0.65
107_W	192_A	0.729	0.64
171_E	192_A	0.729	0.64
108_E	116_V	0.723	0.64
148_C	151_C	0.719	0.63
12_R	37_A	0.719	0.63
120_E	124_E	0.718	0.63
177_G	180_V	0.716	0.63
117_L	155_V	0.712	0.63
156_P	162_G	0.711	0.62
41_K	123_D	0.710	0.62
108_E	111_L	0.707	0.62
152_G	165_F	0.706	0.62
36_R	40_A	0.706	0.62
90_V	123_D	0.705	0.62
185_G	188_A	0.704	0.62
19_A	61_E	0.703	0.62
116_V	159_G	0.702	0.61
95_A	125_A	0.702	0.61
100_A	103_R	0.701	0.61
99_P	102_V	0.698	0.61
25_Y	28_W	0.691	0.60
61_E	84_A	0.689	0.60
20_C	31_A	0.687	0.60
107_W	162_G	0.684	0.59
93_Y	108_E	0.684	0.59
130_Y	134_H	0.679	0.59
74_L	138_S	0.673	0.58
25_Y	30_W	0.672	0.58
122_R	130_Y	0.669	0.58
143_A	153_F	0.667	0.57
82_T	115_R	0.667	0.57
26_R	57_L	0.662	0.57
88_R	170_N	0.659	0.57
146_A	157_L	0.658	0.56
97_D	100_A	0.658	0.56
112_G	162_G	0.656	0.56
45_V	94_T	0.656	0.56
31_A	103_R	0.655	0.56
112_G	122_R	0.655	0.56
82_T	188_A	0.655	0.56
100_A	104_E	0.654	0.56
55_D	150_T	0.653	0.56
76_P	126_A	0.652	0.56
81_P	191_E	0.652	0.56
171_E	188_A	0.652	0.56
4_L	80_L	0.651	0.56
96_T	99_P	0.648	0.55
15_T	51_L	0.646	0.55
97_D	101_V	0.645	0.55
131_D	156_P	0.644	0.55
37_A	41_K	0.639	0.54
77_G	141_A	0.638	0.54
120_E	127_E	0.637	0.54
158_A	163_Q	0.632	0.53
138_S	175_D	0.631	0.53
63_V	66_S	0.631	0.53
2_E	21_T	0.631	0.53
56_A	147_P	0.630	0.53
17_L	33_T	0.626	0.53
77_G	118_S	0.625	0.53
126_A	131_D	0.625	0.53
66_S	83_A	0.624	0.53
48_V	142_R	0.623	0.52
178_R	181_S	0.622	0.52
88_R	124_E	0.617	0.52
96_T	119_R	0.616	0.52
57_L	66_S	0.602	0.50
131_D	137_D	0.601	0.50
92_G	114_A	0.597	0.49
47_E	191_E	0.595	0.49
43_V	46_D	0.589	0.48
31_A	133_D	0.585	0.48
153_F	175_D	0.585	0.48
95_A	101_V	0.584	0.48
120_E	131_D	0.584	0.48
23_P	59_A	0.584	0.48
94_T	102_V	0.583	0.48
7_V	17_L	0.579	0.47
94_T	100_A	0.579	0.47
146_A	192_A	0.578	0.47
101_V	105_V	0.577	0.47
152_G	156_P	0.575	0.47
141_A	185_G	0.573	0.47
65_W	116_V	0.572	0.47
76_P	192_A	0.567	0.46
33_T	49_V	0.567	0.46
16_H	38_P	0.566	0.46
141_A	144_A	0.565	0.46
90_V	119_R	0.565	0.46
76_P	98_D	0.564	0.46
161_L	169_A	0.563	0.45
29_R	56_A	0.563	0.45
123_D	127_E	0.563	0.45
82_T	164_A	0.562	0.45
169_A	182_L	0.560	0.45
98_D	101_V	0.560	0.45
154_L	166_G	0.559	0.45
67_E	71_P	0.559	0.45
172_Y	192_A	0.555	0.45
65_W	76_P	0.554	0.44
14_V	167_V	0.552	0.44
144_A	185_G	0.552	0.44
70_R	88_R	0.547	0.44
114_A	123_D	0.546	0.44
24_G	107_W	0.546	0.44
69_L	76_P	0.545	0.43
23_P	160_S	0.545	0.43
95_A	102_V	0.544	0.43
35_A	40_A	0.543	0.43
46_D	102_V	0.542	0.43
77_G	88_R	0.542	0.43
97_D	152_G	0.542	0.43
58_L	181_S	0.542	0.43
17_L	51_L	0.542	0.43
111_L	165_F	0.537	0.43
72_G	75_G	0.537	0.43
31_A	150_T	0.537	0.43
7_V	54_P	0.532	0.42
47_E	126_A	0.531	0.42
63_V	91_P	0.531	0.42
49_V	94_T	0.530	0.42
176_D	180_V	0.529	0.42
154_L	160_S	0.528	0.41
103_R	106_A	0.528	0.41
15_T	33_T	0.524	0.41
45_V	69_L	0.522	0.41
57_L	100_A	0.521	0.41
92_G	117_L	0.521	0.41
5_G	17_L	0.520	0.41
24_G	93_Y	0.518	0.40
67_E	70_R	0.517	0.40
46_D	66_S	0.517	0.40
124_E	127_E	0.517	0.40
45_V	67_E	0.515	0.40
74_L	78_D	0.514	0.40
76_P	139_P	0.511	0.40
74_L	141_A	0.508	0.39
32_V	48_V	0.508	0.39
149_G	182_L	0.507	0.39
100_A	178_R	0.503	0.39
77_G	82_T	0.501	0.38
65_W	96_T	0.501	0.38
96_T	105_V	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bh5A	4	0.2539	8.1	0.973	Contact Map
1hpiA	1	0.3679	8	0.973	Contact Map
3d0fA	2	0.4508	5.3	0.975	Contact Map
1isuA	2	0.2746	5.3	0.975	Contact Map
1f3zA	2	0.2642	3.8	0.977	Contact Map
1wg2A	1	0.2902	3.7	0.977	Contact Map
1whjA	1	0.228	3.4	0.977	Contact Map
2hx0A	3	0.544	2.9	0.978	Contact Map
1dgwX	1	0.3523	2.8	0.978	Contact Map
3pkaA	3	0.6321	2.8	0.978	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.