DUF2834 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2834 - Protein of unknown function (DUF2834)

PFAM:	PF11196	Sequences: LYLALAVLGLVLPYYFFVPFLAEHGLDLPLFFAALFANPASAFFGLDLLVSAVVLLVFMVVEGRRLGMRRLWLYIVATLLVGVSFGLPLFLYLRER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	96 (95)
Sequences:	5619 (3800)
Seq/√Len:	389.9
META:	0.912

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_A	78_T	2.622	1.00
36_F	42_A	2.364	1.00
3_L	92_Y	2.285	1.00
62_E	90_F	2.259	1.00
74_Y	93_L	2.240	1.00
17_F	43_F	2.201	1.00
1_L	57_V	2.187	1.00
35_L	44_F	2.113	1.00
63_G	71_L	2.033	1.00
29_P	33_A	1.949	1.00
1_L	5_L	1.910	1.00
6_A	85_F	1.882	1.00
10_L	85_F	1.827	1.00
30_L	34_A	1.822	1.00
52_A	56_L	1.690	1.00
56_L	78_T	1.671	1.00
38_N	41_S	1.643	1.00
12_L	46_L	1.628	1.00
8_L	12_L	1.614	1.00
27_D	30_L	1.564	1.00
77_A	85_F	1.562	1.00
55_L	59_M	1.527	1.00
51_S	83_V	1.513	1.00
18_V	22_A	1.499	1.00
78_T	86_G	1.489	1.00
56_L	60_V	1.488	1.00
36_F	46_L	1.446	1.00
55_L	83_V	1.417	1.00
15_Y	19_P	1.348	1.00
35_L	45_G	1.325	1.00
62_E	94_R	1.308	1.00
81_V	85_F	1.289	1.00
9_G	13_P	1.254	1.00
5_L	54_V	1.219	1.00
36_F	45_G	1.208	1.00
16_F	39_P	1.201	1.00
20_F	24_H	1.192	1.00
37_A	41_S	1.184	1.00
49_L	53_V	1.156	1.00
59_M	74_Y	1.146	1.00
10_L	14_Y	1.124	1.00
30_L	33_A	1.120	1.00
56_L	75_I	1.118	1.00
56_L	79_L	1.050	1.00
68_M	90_F	1.039	1.00
41_S	45_G	1.022	1.00
20_F	34_A	1.022	1.00
34_A	38_N	1.000	1.00
55_L	87_L	0.991	1.00
57_V	61_V	0.990	1.00
89_L	93_L	0.987	1.00
42_A	46_L	0.967	1.00
19_P	39_P	0.965	1.00
60_V	75_I	0.961	1.00
61_V	65_R	0.960	1.00
51_S	55_L	0.956	1.00
14_Y	17_F	0.952	1.00
58_F	62_E	0.936	1.00
35_L	41_S	0.933	1.00
24_H	27_D	0.927	1.00
62_E	66_L	0.924	1.00
75_I	79_L	0.902	1.00
69_R	72_W	0.893	1.00
70_R	73_L	0.891	1.00
16_F	19_P	0.882	1.00
68_M	93_L	0.877	1.00
71_L	74_Y	0.873	1.00
15_Y	18_V	0.852	1.00
60_V	64_R	0.849	1.00
2_Y	91_L	0.841	1.00
83_V	86_G	0.829	1.00
19_P	22_A	0.817	1.00
68_M	72_W	0.795	1.00
74_Y	77_A	0.791	1.00
77_A	86_G	0.784	1.00
31_F	40_A	0.777	1.00
74_Y	86_G	0.765	1.00
54_V	88_P	0.765	1.00
51_S	87_L	0.764	1.00
50_V	84_S	0.762	1.00
16_F	46_L	0.741	1.00
76_V	80_L	0.738	1.00
64_R	70_R	0.729	1.00
81_V	84_S	0.724	1.00
12_L	50_V	0.722	1.00
51_S	54_V	0.721	1.00
63_G	68_M	0.712	1.00
6_A	92_Y	0.710	1.00
44_F	48_L	0.706	1.00
64_R	67_G	0.705	1.00
39_P	42_A	0.705	1.00
20_F	40_A	0.696	1.00
34_A	37_A	0.692	0.99
29_P	32_F	0.690	0.99
28_L	32_F	0.690	0.99
13_P	17_F	0.688	0.99
46_L	49_L	0.688	0.99
84_S	88_P	0.687	0.99
65_R	95_E	0.686	0.99
82_G	88_P	0.681	0.99
59_M	71_L	0.676	0.99
19_P	23_E	0.676	0.99
60_V	71_L	0.675	0.99
21_L	24_H	0.670	0.99
63_G	90_F	0.654	0.99
26_L	30_L	0.652	0.99
19_P	24_H	0.650	0.99
68_M	74_Y	0.647	0.99
20_F	25_G	0.643	0.99
43_F	82_G	0.642	0.99
3_L	7_V	0.640	0.99
77_A	89_L	0.635	0.99
5_L	53_V	0.627	0.99
85_F	89_L	0.625	0.99
49_L	52_A	0.620	0.99
57_V	60_V	0.615	0.99
73_L	77_A	0.612	0.99
14_Y	18_V	0.611	0.99
62_E	68_M	0.608	0.99
42_A	45_G	0.607	0.99
45_G	49_L	0.602	0.99
84_S	87_L	0.597	0.99
21_L	25_G	0.588	0.98
59_M	75_I	0.581	0.98
65_R	69_R	0.581	0.98
2_Y	95_E	0.581	0.98
6_A	10_L	0.578	0.98
9_G	50_V	0.575	0.98
31_F	35_L	0.570	0.98
86_G	93_L	0.569	0.98
83_V	87_L	0.556	0.98
35_L	40_A	0.555	0.98
5_L	9_G	0.551	0.97
14_Y	80_L	0.536	0.97
34_A	39_P	0.536	0.97
71_L	76_V	0.530	0.97
62_E	65_R	0.520	0.96
12_L	16_F	0.519	0.96
13_P	20_F	0.519	0.96
68_M	71_L	0.518	0.96
5_L	50_V	0.516	0.96
65_R	68_M	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j8eG	3	0.8854	6.1	0.9	Contact Map
4nv5A	1	0.9271	5.5	0.902	Contact Map
1iijA	1	0.3646	5.4	0.902	Contact Map
4px7A	1	0.9375	4.4	0.906	Contact Map
2m20A	2	0.3125	3.2	0.913	Contact Map
1rzhM	1	0.9583	3.1	0.913	Contact Map
4fbzA	3	0.6458	3	0.914	Contact Map
4aw6A	2	0.8958	2.5	0.917	Contact Map
1eysM	1	0.9583	2.4	0.918	Contact Map
4jq6A	3	0.5833	2.1	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.