DUF2975 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2975 - Protein of unknown function (DUF2975)

PFAM:	PF11188	Sequences: WIAADLAELYPEFAYLRYPFLLLALLAAILFFVALYQLRKLLGTVRRGDPFSPENVRRLRRIGYCLLAIALLYVAGGILLALLAAFDDAPGLVLLGLGISFASLLIGLLLLVLARVFREGVELKEENDLTV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	131 (115)
Sequences:	14416 (10823)
Seq/√Len:	1009.2
META:	0.838

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
124_K	128_D	4.126	1.00
37_Q	61_R	3.130	1.00
123_L	127_N	3.106	1.00
37_Q	58_R	2.763	1.00
33_V	65_C	2.645	1.00
119_E	122_E	2.555	1.00
63_G	111_L	2.499	1.00
56_V	121_V	2.324	1.00
44_T	58_R	2.172	1.00
115_R	118_R	2.058	1.00
63_G	114_A	2.051	1.00
57_R	61_R	2.046	1.00
67_L	107_G	1.967	1.00
34_A	62_I	1.962	1.00
33_V	37_Q	1.950	1.00
44_T	55_N	1.943	1.00
36_Y	40_K	1.901	1.00
70_A	73_Y	1.850	1.00
49_D	52_S	1.835	1.00
44_T	49_D	1.632	1.00
63_G	107_G	1.621	1.00
60_R	118_R	1.604	1.00
121_V	125_E	1.578	1.00
64_Y	68_A	1.482	1.00
56_V	114_A	1.372	1.00
41_L	55_N	1.361	1.00
33_V	61_R	1.340	1.00
92_L	95_L	1.320	1.00
115_R	119_E	1.290	1.00
125_E	129_L	1.285	1.00
42_L	45_V	1.260	1.00
32_F	36_Y	1.240	1.00
119_E	124_K	1.237	1.00
81_A	84_A	1.225	1.00
40_K	58_R	1.221	1.00
118_R	121_V	1.214	1.00
64_Y	111_L	1.212	1.00
66_L	110_L	1.200	1.00
94_L	97_L	1.196	1.00
66_L	107_G	1.188	1.00
125_E	128_D	1.188	1.00
44_T	54_E	1.185	1.00
36_Y	39_R	1.180	1.00
39_R	43_G	1.172	1.00
48_G	119_E	1.172	1.00
49_D	124_K	1.151	1.00
62_I	110_L	1.133	1.00
53_P	125_E	1.130	1.00
118_R	122_E	1.129	1.00
81_A	85_A	1.115	1.00
37_Q	65_C	1.080	1.00
51_F	123_L	1.072	1.00
37_Q	40_K	1.022	1.00
80_L	85_A	1.010	1.00
53_P	118_R	1.002	1.00
70_A	74_V	1.002	1.00
61_R	65_C	1.001	1.00
78_I	81_A	0.986	1.00
73_Y	76_G	0.980	1.00
127_N	130_T	0.969	1.00
77_G	81_A	0.966	1.00
60_R	114_A	0.965	1.00
79_L	82_L	0.964	1.00
79_L	84_A	0.964	1.00
45_V	117_F	0.962	1.00
65_C	69_I	0.921	1.00
57_R	60_R	0.907	1.00
59_L	117_F	0.900	1.00
56_V	60_R	0.896	1.00
43_G	47_R	0.890	1.00
29_I	33_V	0.887	1.00
107_G	111_L	0.882	1.00
78_I	82_L	0.879	1.00
43_G	46_R	0.872	1.00
44_T	52_S	0.865	1.00
50_P	116_V	0.864	1.00
45_V	50_P	0.862	1.00
60_R	115_R	0.860	1.00
72_L	76_G	0.854	1.00
61_R	64_Y	0.853	1.00
93_V	96_G	0.848	1.00
82_L	85_A	0.848	1.00
45_V	55_N	0.848	1.00
53_P	57_R	0.844	1.00
60_R	64_Y	0.843	1.00
74_V	78_I	0.842	1.00
39_R	46_R	0.838	1.00
124_K	127_N	0.833	1.00
86_F	89_A	0.830	1.00
41_L	45_V	0.798	1.00
91_G	95_L	0.794	1.00
70_A	76_G	0.793	1.00
59_L	110_L	0.787	1.00
52_S	55_N	0.787	1.00
54_E	58_R	0.781	1.00
72_L	75_A	0.773	1.00
31_F	34_A	0.772	1.00
53_P	121_V	0.748	1.00
24_A	27_A	0.748	1.00
71_L	75_A	0.744	1.00
72_L	80_L	0.739	1.00
126_E	129_L	0.738	1.00
80_L	84_A	0.738	1.00
70_A	75_A	0.724	1.00
35_L	39_R	0.720	1.00
109_L	113_L	0.715	1.00
19_P	22_L	0.715	1.00
114_A	118_R	0.715	1.00
30_L	69_I	0.712	1.00
41_L	58_R	0.711	1.00
76_G	85_A	0.693	1.00
87_D	90_P	0.685	1.00
56_V	63_G	0.682	1.00
54_E	57_R	0.679	1.00
73_Y	80_L	0.674	1.00
94_L	98_G	0.672	1.00
80_L	83_L	0.667	1.00
127_N	131_V	0.665	1.00
50_P	119_E	0.656	1.00
120_G	123_L	0.652	1.00
76_G	80_L	0.645	1.00
77_G	83_L	0.636	1.00
89_A	92_L	0.635	1.00
26_L	29_I	0.632	1.00
103_S	107_G	0.628	1.00
17_R	21_L	0.627	1.00
78_I	84_A	0.625	1.00
73_Y	77_G	0.621	1.00
27_A	30_L	0.621	1.00
116_V	120_G	0.618	1.00
99_I	102_A	0.618	1.00
77_G	85_A	0.614	1.00
34_A	65_C	0.612	1.00
32_F	35_L	0.604	1.00
51_F	120_G	0.604	1.00
122_E	125_E	0.603	1.00
74_V	77_G	0.601	1.00
75_A	78_I	0.597	1.00
28_A	32_F	0.590	1.00
71_L	74_V	0.580	1.00
76_G	79_L	0.579	1.00
72_L	84_A	0.578	1.00
72_L	81_A	0.568	1.00
77_G	84_A	0.567	1.00
21_L	25_L	0.561	1.00
75_A	79_L	0.554	1.00
40_K	54_E	0.554	1.00
78_I	83_L	0.553	1.00
44_T	50_P	0.545	1.00
73_Y	79_L	0.540	1.00
66_L	106_I	0.539	1.00
62_I	66_L	0.538	1.00
70_A	77_G	0.538	1.00
85_A	89_A	0.536	1.00
85_A	88_D	0.531	1.00
84_A	90_P	0.528	1.00
41_L	62_I	0.526	1.00
52_S	56_V	0.524	1.00
32_F	39_R	0.520	1.00
104_L	107_G	0.520	1.00
120_G	124_K	0.514	1.00
77_G	80_L	0.513	1.00
117_F	120_G	0.513	1.00
69_I	103_S	0.510	1.00
34_A	37_Q	0.510	1.00
56_V	118_R	0.508	1.00
115_R	122_E	0.507	1.00
95_L	98_G	0.505	1.00
45_V	59_L	0.505	1.00
91_G	94_L	0.502	1.00
30_L	65_C	0.502	1.00
55_N	58_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4hyjA	2	0.8855	23.8	0.875	Contact Map
4qi1A	3	0.8473	14.8	0.886	Contact Map
3m73A	3	0.3969	7.3	0.901	Contact Map
4xtlA	1	0.8702	4.2	0.912	Contact Map
4hw9A	3	0.855	3.6	0.915	Contact Map
5ajiA	3	0.9008	3.2	0.917	Contact Map
3am6A	3	0.8397	3.2	0.917	Contact Map
4fbzA	3	0.9008	3.1	0.917	Contact Map
4p6vB	1	0.4504	2.6	0.921	Contact Map
3udcA	3	0.9008	2.6	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.