DUF2971 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2971 - Protein of unknown function (DUF2971)

PFAM:	PF11185	Sequences: MWSHYADNHKGVCIGFDTDKLFELLKELLAELLKLFPVIYSDERPKIDILELLDELLELLEELDEILLTKSKDWSYEKEWRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (79)
Sequences:	17432 (16031)
Seq/√Len:	1803.7
META:	0.901

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_H	76_Y	4.434	1.00
7_D	10_K	4.178	1.00
3_S	74_W	3.379	1.00
3_S	8_N	2.674	1.00
72_K	75_S	2.422	1.00
42_D	72_K	2.316	1.00
4_H	77_E	2.248	1.00
18_T	80_W	1.985	1.00
3_S	9_H	1.937	1.00
4_H	74_W	1.713	1.00
3_S	76_Y	1.690	1.00
12_V	15_G	1.645	1.00
1_M	13_C	1.579	1.00
18_T	21_L	1.549	1.00
1_M	4_H	1.516	1.00
74_W	77_E	1.477	1.00
31_E	34_K	1.467	1.00
1_M	76_Y	1.464	1.00
12_V	16_F	1.386	1.00
6_A	11_G	1.374	1.00
71_S	74_W	1.344	1.00
20_K	23_E	1.314	1.00
30_A	34_K	1.280	1.00
25_L	28_L	1.276	1.00
66_I	69_T	1.239	1.00
21_L	24_L	1.224	1.00
27_E	30_A	1.112	1.00
62_E	66_I	1.086	1.00
15_G	18_T	1.085	1.00
17_D	20_K	1.045	1.00
16_F	74_W	1.022	1.00
9_H	74_W	0.980	1.00
4_H	8_N	0.972	1.00
29_L	32_L	0.969	1.00
29_L	33_L	0.963	1.00
41_S	44_R	0.962	1.00
25_L	30_A	0.955	1.00
62_E	65_E	0.945	1.00
42_D	45_P	0.942	1.00
28_L	32_L	0.941	1.00
4_H	73_D	0.916	1.00
13_C	16_F	0.915	1.00
2_W	5_Y	0.909	1.00
24_L	28_L	0.889	1.00
1_M	15_G	0.889	1.00
13_C	74_W	0.880	1.00
53_L	58_E	0.879	1.00
70_K	74_W	0.874	1.00
63_L	67_L	0.872	1.00
1_M	16_F	0.860	1.00
5_Y	74_W	0.854	1.00
18_T	22_F	0.836	1.00
21_L	25_L	0.836	1.00
65_E	69_T	0.831	1.00
41_S	45_P	0.830	1.00
57_L	60_L	0.814	1.00
6_A	13_C	0.805	1.00
57_L	61_E	0.804	1.00
28_L	31_E	0.795	1.00
30_A	33_L	0.789	1.00
28_L	33_L	0.788	1.00
6_A	10_K	0.781	1.00
75_S	78_K	0.780	1.00
64_D	67_L	0.777	1.00
16_F	80_W	0.776	1.00
54_D	57_L	0.776	1.00
44_R	71_S	0.769	1.00
54_D	58_E	0.764	1.00
65_E	68_L	0.761	1.00
4_H	13_C	0.756	1.00
16_F	71_S	0.748	1.00
3_S	71_S	0.741	1.00
17_D	21_L	0.740	1.00
22_F	25_L	0.710	1.00
77_E	81_R	0.700	1.00
1_M	5_Y	0.694	1.00
53_L	57_L	0.690	1.00
43_E	47_I	0.689	1.00
61_E	64_D	0.678	1.00
44_R	48_D	0.667	1.00
41_S	72_K	0.658	1.00
24_L	29_L	0.639	1.00
25_L	29_L	0.636	1.00
3_S	6_A	0.636	1.00
6_A	38_V	0.635	1.00
26_K	29_L	0.632	1.00
19_D	22_F	0.628	1.00
23_E	28_L	0.627	1.00
50_L	54_D	0.621	1.00
56_L	59_L	0.619	1.00
23_E	26_K	0.619	1.00
24_L	27_E	0.616	1.00
49_I	52_L	0.612	1.00
63_L	66_I	0.608	1.00
9_H	71_S	0.604	1.00
1_M	80_W	0.604	1.00
16_F	70_K	0.593	1.00
29_L	34_K	0.591	1.00
61_E	67_L	0.589	1.00
4_H	71_S	0.582	1.00
56_L	60_L	0.575	1.00
21_L	26_K	0.569	1.00
45_P	48_D	0.563	1.00
22_F	27_E	0.560	1.00
58_E	61_E	0.558	1.00
3_S	73_D	0.557	1.00
64_D	68_L	0.555	1.00
61_E	65_E	0.546	1.00
27_E	32_L	0.545	1.00
13_C	77_E	0.531	1.00
27_E	31_E	0.530	1.00
59_L	64_D	0.530	1.00
12_V	74_W	0.526	1.00
6_A	9_H	0.521	1.00
27_E	34_K	0.517	1.00
59_L	62_E	0.511	1.00
71_S	76_Y	0.508	1.00
57_L	62_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dmeA	2	0.3293	2.2	0.88	Contact Map
4fusA	1	0.8537	2.1	0.883	Contact Map
2co3A	2	0.8415	2	0.883	Contact Map
1l1yA	1	0.878	1.8	0.887	Contact Map
3n12A	1	0.3537	1.8	0.887	Contact Map
1jndA	1	0.3415	1.5	0.891	Contact Map
1sdiA	1	0.4146	1.5	0.892	Contact Map
4jz5A	1	0.378	1.4	0.892	Contact Map
3ianA	1	0.4878	1.4	0.894	Contact Map
3lvqE	1	0.939	1.4	0.894	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.