YflT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YflT - Heat induced stress protein YflT

PFAM:	PF11181	Sequences: VGVFDNEEEAERAIEELKAAGFSEDDISVVAKDKDRTERLAEETDVNVEGGAEAGGLWGAIANLFTGAGDELRGALVGLGIPEEEAERYEEELDAGKILVI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	101 (101)
Sequences:	2037 (1605)
Seq/√Len:	159.7
META:	0.617

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
92_E	97_K	2.707	1.00
5_D	97_K	2.634	1.00
90_E	94_D	2.464	1.00
18_K	24_E	2.407	1.00
10_A	100_V	2.348	1.00
3_V	92_E	2.342	1.00
23_S	26_D	2.210	1.00
64_L	67_G	2.041	1.00
13_A	100_V	2.011	1.00
6_N	9_E	1.990	1.00
83_E	87_E	1.988	1.00
70_D	74_G	1.903	1.00
59_G	65_F	1.794	1.00
92_E	95_A	1.784	1.00
47_N	50_G	1.634	1.00
56_G	59_G	1.608	1.00
55_G	60_A	1.597	1.00
27_I	100_V	1.584	1.00
13_A	16_E	1.551	1.00
71_E	74_G	1.497	1.00
50_G	53_E	1.488	1.00
55_G	62_A	1.473	1.00
4_F	13_A	1.459	1.00
60_A	64_L	1.433	1.00
80_G	86_A	1.401	1.00
16_E	20_A	1.385	1.00
76_L	81_I	1.375	1.00
91_E	95_A	1.358	1.00
15_E	19_A	1.336	1.00
93_L	99_L	1.333	1.00
30_V	93_L	1.330	1.00
12_R	16_E	1.326	1.00
77_V	83_E	1.318	1.00
82_P	85_E	1.294	1.00
5_D	9_E	1.290	1.00
10_A	98_I	1.280	1.00
76_L	86_A	1.259	1.00
89_Y	99_L	1.259	1.00
37_T	41_A	1.258	1.00
62_A	66_T	1.248	1.00
22_F	26_D	1.239	1.00
63_N	66_T	1.220	1.00
91_E	94_D	1.189	1.00
63_N	67_G	1.161	1.00
76_L	80_G	1.153	1.00
14_I	27_I	1.136	1.00
2_G	13_A	1.132	1.00
51_G	54_A	1.096	1.00
3_V	99_L	1.052	0.99
46_V	50_G	1.045	0.99
57_L	60_A	1.030	0.99
69_G	72_L	1.007	0.99
58_W	64_L	1.000	0.99
4_F	100_V	0.989	0.99
16_E	19_A	0.981	0.99
7_E	11_E	0.976	0.99
59_G	62_A	0.975	0.99
57_L	61_I	0.970	0.99
15_E	18_K	0.949	0.99
10_A	27_I	0.931	0.98
55_G	63_N	0.927	0.98
31_A	98_I	0.920	0.98
88_R	92_E	0.915	0.98
56_G	60_A	0.915	0.98
60_A	63_N	0.913	0.98
48_V	51_G	0.912	0.98
47_N	51_G	0.912	0.98
69_G	73_R	0.905	0.98
88_R	91_E	0.903	0.98
22_F	79_L	0.895	0.98
76_L	99_L	0.894	0.98
58_W	65_F	0.892	0.98
12_R	15_E	0.886	0.98
41_A	48_V	0.883	0.98
61_I	66_T	0.882	0.98
78_G	86_A	0.872	0.98
59_G	64_L	0.854	0.97
11_E	18_K	0.844	0.97
27_I	98_I	0.842	0.97
4_F	22_F	0.835	0.97
84_E	88_R	0.823	0.96
3_V	89_Y	0.818	0.96
85_E	88_R	0.808	0.96
50_G	54_A	0.802	0.96
81_I	85_E	0.797	0.96
14_I	100_V	0.789	0.96
19_A	29_V	0.782	0.95
76_L	82_P	0.775	0.95
12_R	19_A	0.771	0.95
32_K	94_D	0.769	0.95
55_G	69_G	0.764	0.95
77_V	86_A	0.758	0.94
28_S	88_R	0.757	0.94
20_A	101_I	0.754	0.94
61_I	64_L	0.751	0.94
11_E	15_E	0.745	0.94
59_G	63_N	0.744	0.94
49_E	52_A	0.740	0.94
36_R	42_E	0.724	0.93
93_L	96_G	0.717	0.93
55_G	75_A	0.709	0.92
61_I	72_L	0.707	0.92
9_E	12_R	0.706	0.92
11_E	40_L	0.697	0.92
35_D	40_L	0.693	0.91
79_L	85_E	0.690	0.91
18_K	78_G	0.667	0.90
60_A	66_T	0.666	0.90
73_R	90_E	0.656	0.89
15_E	44_T	0.648	0.88
71_E	75_A	0.645	0.88
14_I	31_A	0.644	0.88
68_A	71_E	0.640	0.88
82_P	86_A	0.630	0.87
60_A	65_F	0.628	0.87
29_V	37_T	0.627	0.87
57_L	64_L	0.625	0.87
20_A	88_R	0.624	0.86
40_L	98_I	0.608	0.85
57_L	62_A	0.607	0.85
56_G	67_G	0.603	0.85
62_A	67_G	0.597	0.84
76_L	87_E	0.596	0.84
4_F	17_L	0.592	0.83
35_D	39_R	0.583	0.83
45_D	49_E	0.583	0.83
63_N	75_A	0.581	0.82
8_E	12_R	0.577	0.82
50_G	64_L	0.573	0.81
23_S	52_A	0.567	0.81
69_G	74_G	0.563	0.80
30_V	49_E	0.563	0.80
13_A	28_S	0.560	0.80
28_S	56_G	0.559	0.80
44_T	49_E	0.552	0.79
48_V	52_A	0.542	0.78
7_E	29_V	0.539	0.77
40_L	43_E	0.538	0.77
52_A	74_G	0.529	0.76
86_A	90_E	0.529	0.76
27_I	34_K	0.526	0.76
16_E	36_R	0.525	0.76
56_G	72_L	0.524	0.75
14_I	24_E	0.515	0.74
68_A	74_G	0.512	0.74
59_G	67_G	0.510	0.73
38_E	41_A	0.509	0.73
43_E	51_G	0.508	0.73
58_W	66_T	0.506	0.73
89_Y	96_G	0.506	0.73
79_L	82_P	0.500	0.72
57_L	67_G	0.500	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1x60A	1	0.5644	42.2	0.828	Contact Map
1utaA	1	0.5842	36.4	0.834	Contact Map
3lfuA	1	0.9901	17.1	0.858	Contact Map
3do6A	3	0.3366	16.6	0.859	Contact Map
4c2uA	1	0.9901	14.5	0.863	Contact Map
4pnhA	4	0.8119	13.1	0.865	Contact Map
2lfvA	1	0.3861	13.1	0.865	Contact Map
1tdjA	2	0.802	12.9	0.866	Contact Map
3ju3A	4	0.9307	12.2	0.867	Contact Map
2fprA	2	0.9406	12.1	0.868	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.