DUF2922 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2922 - Protein of unknown function (DUF2922)

PFAM:	PF11148	Sequences: KTLELTFKTEEGKTVTISIPDPKEDLTAAEVKAAMDTIIAKNIFTTSGGDLVSKKSARIVETTVTEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	67 (67)
Sequences:	3033 (2316)
Seq/√Len:	282.9
META:	0.675

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_D	54_K	2.401	1.00
8_K	53_S	2.371	1.00
27_T	30_E	2.308	1.00
35_M	54_K	2.237	1.00
8_K	55_K	2.114	1.00
4_E	16_T	2.071	1.00
42_N	50_D	1.942	1.00
28_A	32_K	1.827	1.00
6_T	56_S	1.823	1.00
37_T	41_K	1.814	1.00
61_E	65_T	1.775	1.00
46_T	49_G	1.736	1.00
36_D	40_A	1.729	1.00
32_K	54_K	1.640	1.00
4_E	58_R	1.639	1.00
23_K	30_E	1.611	1.00
10_E	50_D	1.535	1.00
39_I	54_K	1.525	1.00
2_T	62_T	1.506	1.00
14_T	55_K	1.492	1.00
6_T	14_T	1.476	1.00
58_R	64_V	1.444	1.00
9_T	48_G	1.325	1.00
5_L	35_M	1.311	1.00
34_A	38_I	1.263	1.00
15_V	51_L	1.259	1.00
9_T	15_V	1.246	1.00
2_T	18_S	1.230	1.00
6_T	16_T	1.195	1.00
8_K	14_T	1.147	1.00
4_E	18_S	1.144	1.00
4_E	60_V	1.113	1.00
8_K	12_G	1.108	1.00
29_A	33_A	1.091	1.00
32_K	36_D	1.090	1.00
1_K	24_E	1.020	1.00
31_V	67_L	1.016	1.00
39_I	51_L	1.004	1.00
56_S	66_E	0.967	1.00
2_T	20_P	0.941	1.00
37_T	40_A	0.917	1.00
9_T	49_G	0.895	1.00
11_E	48_G	0.888	1.00
44_F	51_L	0.882	1.00
17_I	38_I	0.882	1.00
13_K	48_G	0.873	1.00
23_K	27_T	0.864	1.00
22_P	34_A	0.836	1.00
9_T	46_T	0.798	0.99
31_V	57_A	0.788	0.99
22_P	26_L	0.782	0.99
13_K	47_S	0.775	0.99
33_A	37_T	0.772	0.99
7_F	35_M	0.768	0.99
22_P	59_I	0.757	0.99
34_A	37_T	0.755	0.99
45_T	50_D	0.753	0.99
10_E	52_V	0.738	0.99
23_K	26_L	0.737	0.99
15_V	20_P	0.696	0.98
1_K	61_E	0.693	0.98
39_I	53_S	0.681	0.98
26_L	59_I	0.680	0.98
60_V	64_V	0.680	0.98
46_T	50_D	0.671	0.98
10_E	49_G	0.668	0.98
35_M	57_A	0.659	0.98
11_E	49_G	0.649	0.97
35_M	39_I	0.645	0.97
5_L	19_I	0.643	0.97
46_T	51_L	0.632	0.97
5_L	54_K	0.617	0.97
58_R	66_E	0.605	0.96
28_A	67_L	0.595	0.96
1_K	22_P	0.592	0.96
6_T	58_R	0.592	0.96
26_L	31_V	0.591	0.96
3_L	22_P	0.586	0.95
10_E	48_G	0.582	0.95
18_S	60_V	0.577	0.95
12_G	34_A	0.574	0.95
9_T	17_I	0.568	0.95
19_I	41_K	0.553	0.94
28_A	31_V	0.553	0.94
38_I	41_K	0.551	0.94
58_R	62_T	0.548	0.94
24_E	34_A	0.547	0.93
30_E	33_A	0.546	0.93
26_L	34_A	0.546	0.93
18_S	22_P	0.546	0.93
30_E	34_A	0.538	0.93
11_E	47_S	0.537	0.93
19_I	61_E	0.525	0.92
32_K	67_L	0.524	0.92
39_I	52_V	0.521	0.92
6_T	55_K	0.521	0.92
9_T	51_L	0.518	0.92
45_T	49_G	0.505	0.90
4_E	44_F	0.501	0.90
42_N	51_L	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1b7yB	2	0.6716	19.5	0.816	Contact Map
2rhqB	2	0.7015	18	0.82	Contact Map
3pcoB	2	0.7761	15.5	0.824	Contact Map
4p72A	2	0.7612	12.9	0.831	Contact Map
3cmqA	1	0.7761	10.8	0.836	Contact Map
1ksiA	2	0.6866	9.9	0.839	Contact Map
3loyA	2	0.6567	9.9	0.84	Contact Map
3a0oA	1	0.3134	8.9	0.843	Contact Map
1hn0A	1	0.3433	7.3	0.849	Contact Map
4dezA	2	0	6.7	0.851	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.