DUF2919 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2919 - Protein of unknown function (DUF2919)

PFAM:	PF11143	Sequences: YSPEDYDKHGCLKPPLLLWLVLLFLARTWLLFVMAGASRQQGSDLLALFYPDKSDFYLGLLAGLPALLLLLLSGRRPRASKWVRRLWRHGRWLLLLAALLDLALQLYHLWLQHGQFSWLLALQLLLDLWALLYLLRSRRLRDCFAD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	146 (145)
Sequences:	709 (521)
Seq/√Len:	43.3
META:	0.597

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
1_Y	142_D	4.673	1.00
29_W	60_L	3.436	1.00
69_L	90_G	3.103	1.00
28_T	63_G	2.984	1.00
90_G	144_F	2.600	1.00
26_A	29_W	2.536	1.00
28_T	59_G	2.446	1.00
2_S	5_D	2.439	1.00
139_R	143_C	2.421	1.00
29_W	63_G	2.330	1.00
45_L	48_L	2.292	1.00
72_L	76_R	2.234	1.00
71_L	76_R	2.091	0.99
21_V	130_A	2.087	0.99
98_A	131_L	2.077	0.99
116_F	121_A	2.051	0.99
38_S	41_Q	2.038	0.99
7_D	11_C	2.034	0.99
66_A	94_L	1.975	0.99
1_Y	12_L	1.894	0.99
5_D	139_R	1.881	0.99
35_A	41_Q	1.806	0.98
71_L	74_G	1.803	0.98
39_R	46_L	1.771	0.98
25_L	98_A	1.757	0.98
45_L	49_F	1.755	0.98
38_S	42_G	1.742	0.98
75_R	87_W	1.709	0.98
88_R	126_L	1.614	0.97
118_W	121_A	1.581	0.96
6_Y	12_L	1.581	0.96
89_H	92_W	1.562	0.96
12_L	142_D	1.548	0.96
24_F	127_D	1.525	0.95
13_K	24_F	1.519	0.95
90_G	98_A	1.512	0.95
69_L	93_L	1.509	0.95
95_L	135_L	1.497	0.95
93_L	106_L	1.495	0.95
42_G	46_L	1.467	0.94
130_A	137_S	1.460	0.94
101_D	104_L	1.446	0.94
139_R	144_F	1.365	0.92
86_L	90_G	1.344	0.91
41_Q	44_D	1.336	0.91
90_G	93_L	1.250	0.87
66_A	97_A	1.238	0.87
18_L	140_L	1.235	0.87
26_A	32_F	1.215	0.86
96_L	99_L	1.181	0.84
59_G	63_G	1.170	0.84
138_R	141_R	1.131	0.82
39_R	42_G	1.131	0.82
98_A	130_A	1.122	0.81
87_W	90_G	1.116	0.81
133_Y	140_L	1.104	0.80
129_W	132_L	1.078	0.78
99_L	103_A	1.077	0.78
23_L	70_L	1.077	0.78
78_R	81_K	1.074	0.78
2_S	6_Y	1.057	0.77
18_L	60_L	1.054	0.77
57_Y	124_L	1.041	0.76
35_A	38_S	1.040	0.76
32_F	36_G	1.038	0.76
94_L	134_L	1.024	0.75
96_L	100_L	1.021	0.74
41_Q	49_F	1.009	0.74
15_P	143_C	0.988	0.72
77_P	84_R	0.988	0.72
117_S	122_L	0.986	0.72
35_A	42_G	0.985	0.72
3_P	139_R	0.979	0.71
87_W	94_L	0.978	0.71
60_L	63_G	0.973	0.71
65_P	68_L	0.972	0.71
7_D	28_T	0.961	0.70
24_F	126_L	0.948	0.69
128_L	141_R	0.945	0.69
125_L	129_W	0.934	0.68
73_S	76_R	0.933	0.68
99_L	128_L	0.932	0.67
36_G	42_G	0.918	0.66
69_L	134_L	0.909	0.65
109_L	113_H	0.907	0.65
38_S	46_L	0.905	0.65
14_P	131_L	0.895	0.64
10_G	46_L	0.883	0.63
47_A	72_L	0.879	0.63
21_V	25_L	0.876	0.63
70_L	131_L	0.868	0.62
96_L	125_L	0.864	0.61
41_Q	46_L	0.853	0.60
21_V	40_Q	0.852	0.60
85_R	88_R	0.849	0.60
92_W	96_L	0.848	0.60
27_R	63_G	0.847	0.60
14_P	143_C	0.846	0.60
63_G	101_D	0.844	0.60
6_Y	13_K	0.839	0.59
75_R	78_R	0.836	0.59
51_P	57_Y	0.836	0.59
61_L	86_L	0.822	0.58
66_A	141_R	0.813	0.57
17_L	133_Y	0.801	0.56
51_P	127_D	0.801	0.56
23_L	61_L	0.797	0.55
10_G	29_W	0.786	0.54
66_A	103_A	0.780	0.54
89_H	93_L	0.775	0.53
7_D	91_R	0.773	0.53
50_Y	59_G	0.770	0.53
29_W	41_Q	0.768	0.53
103_A	138_R	0.767	0.52
113_H	121_A	0.765	0.52
104_L	132_L	0.764	0.52
107_Y	137_S	0.762	0.52
22_L	94_L	0.758	0.52
34_M	145_A	0.753	0.51
48_L	51_P	0.751	0.51
137_S	140_L	0.733	0.49
122_L	126_L	0.729	0.49
67_L	106_L	0.729	0.49
38_S	63_G	0.725	0.48
68_L	102_L	0.724	0.48
24_F	27_R	0.714	0.47
12_L	143_C	0.710	0.47
28_T	50_Y	0.706	0.47
95_L	122_L	0.705	0.47
110_W	114_G	0.704	0.46
1_Y	4_E	0.701	0.46
15_P	18_L	0.699	0.46
19_W	101_D	0.689	0.45
7_D	19_W	0.686	0.45
89_H	96_L	0.686	0.45
61_L	103_A	0.685	0.45
116_F	129_W	0.679	0.44
23_L	66_A	0.678	0.44
29_W	133_Y	0.671	0.43
123_Q	127_D	0.671	0.43
68_L	92_W	0.670	0.43
29_W	38_S	0.670	0.43
114_G	121_A	0.668	0.43
99_L	106_L	0.668	0.43
86_L	140_L	0.651	0.41
37_A	50_Y	0.650	0.41
45_L	128_L	0.643	0.41
93_L	100_L	0.635	0.40
87_W	144_F	0.629	0.39
45_L	52_D	0.628	0.39
69_L	144_F	0.622	0.39
3_P	24_F	0.621	0.39
71_L	118_W	0.620	0.39
15_P	140_L	0.617	0.38
71_L	103_A	0.611	0.38
46_L	50_Y	0.609	0.38
17_L	26_A	0.609	0.38
104_L	121_A	0.604	0.37
44_D	47_A	0.604	0.37
31_L	118_W	0.603	0.37
15_P	127_D	0.600	0.37
3_P	83_V	0.598	0.37
35_A	123_Q	0.593	0.36
43_S	102_L	0.591	0.36
19_W	26_A	0.589	0.36
14_P	30_L	0.587	0.36
35_A	50_Y	0.586	0.36
30_L	87_W	0.584	0.35
105_Q	112_Q	0.583	0.35
40_Q	43_S	0.582	0.35
19_W	36_G	0.580	0.35
96_L	124_L	0.578	0.35
116_F	120_L	0.575	0.35
86_L	89_H	0.571	0.34
25_L	78_R	0.570	0.34
105_Q	109_L	0.569	0.34
86_L	122_L	0.568	0.34
48_L	109_L	0.563	0.34
1_Y	6_Y	0.562	0.34
22_L	80_S	0.561	0.33
22_L	75_R	0.556	0.33
22_L	73_S	0.554	0.33
96_L	110_W	0.553	0.33
7_D	108_H	0.551	0.33
70_L	78_R	0.551	0.33
61_L	64_L	0.550	0.33
6_Y	48_L	0.550	0.33
118_W	122_L	0.549	0.32
33_V	115_Q	0.546	0.32
36_G	41_Q	0.546	0.32
47_A	83_V	0.546	0.32
50_Y	63_G	0.545	0.32
113_H	117_S	0.542	0.32
24_F	30_L	0.541	0.32
60_L	133_Y	0.539	0.32
95_L	102_L	0.536	0.31
23_L	58_L	0.530	0.31
95_L	136_R	0.530	0.31
45_L	50_Y	0.526	0.31
21_V	94_L	0.526	0.31
60_L	82_W	0.525	0.30
69_L	97_A	0.523	0.30
45_L	56_F	0.521	0.30
73_S	140_L	0.520	0.30
104_L	133_Y	0.519	0.30
103_A	107_Y	0.517	0.30
131_L	140_L	0.514	0.30
51_P	56_F	0.513	0.30
67_L	117_S	0.512	0.29
34_M	47_A	0.512	0.29
28_T	35_A	0.510	0.29
109_L	119_L	0.507	0.29
81_K	107_Y	0.507	0.29
28_T	56_F	0.507	0.29
20_L	134_L	0.505	0.29
14_P	42_G	0.503	0.29
85_R	141_R	0.502	0.29
27_R	53_K	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qncA	2	0.4932	3.6	0.945	Contact Map
2a65A	2	0.5753	2.3	0.95	Contact Map
2d8rA	1	0.226	1.7	0.954	Contact Map
4k5yA	1	0.9041	1.6	0.955	Contact Map
4oo9A	1	0.6986	1.5	0.955	Contact Map
2hqvA	2	0.2877	1.4	0.956	Contact Map
1nxmA	2	0.3082	1.2	0.958	Contact Map
4qndA	2	0.5959	1.2	0.958	Contact Map
4l6rA	1	0.9658	1.1	0.959	Contact Map
3lm8A	2	0.2877	1.1	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.