DUF2889 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2889 - Protein of unknown function (DUF2889)

PFAM:	PF11136	Sequences: HTRRIRCDGYRRDDGLWDIEGHLTDTKTYDFGLADGERPAGEPVHDMWLRLTVDDDLTIVDAEAVMDALPYGECPEIAPAYQRLVGLRIGPGFRRAVRERLGGVRGCTHLTELLRALATAAFQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	123 (123)
Sequences:	6338 (4173)
Seq/√Len:	376.3
META:	0.937

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_M	69_L	4.140	1.00
61_D	85_V	3.139	1.00
96_A	100_R	2.806	1.00
22_H	46_D	2.730	1.00
96_A	99_E	2.539	1.00
82_Q	85_V	2.436	1.00
46_D	68_A	2.435	1.00
87_L	96_A	2.280	1.00
54_D	58_T	2.046	1.00
61_D	82_Q	2.034	1.00
51_L	62_A	1.935	1.00
30_D	39_P	1.917	1.00
52_T	61_D	1.902	1.00
81_Y	111_T	1.893	1.00
83_R	105_R	1.887	1.00
58_T	88_R	1.800	1.00
2_T	6_R	1.781	1.00
54_D	60_V	1.764	1.00
16_L	60_V	1.757	1.00
48_W	67_D	1.729	1.00
32_G	37_E	1.695	1.00
48_W	65_V	1.645	1.00
50_R	63_E	1.606	1.00
22_H	48_W	1.586	1.00
2_T	8_D	1.556	1.00
18_D	52_T	1.552	1.00
87_L	100_R	1.511	1.00
19_I	51_L	1.503	1.00
12_R	18_D	1.499	1.00
30_D	40_A	1.481	1.00
80_A	83_R	1.469	1.00
30_D	37_E	1.451	1.00
69_L	75_P	1.447	1.00
59_I	93_F	1.446	1.00
39_P	42_E	1.408	1.00
20_E	50_R	1.406	1.00
24_T	46_D	1.390	1.00
66_M	78_A	1.369	1.00
33_L	36_G	1.365	1.00
75_P	78_A	1.354	1.00
88_R	91_P	1.335	1.00
53_V	89_I	1.334	1.00
46_D	67_D	1.285	1.00
95_R	99_E	1.285	1.00
83_R	100_R	1.239	1.00
51_L	59_I	1.194	1.00
116_A	120_A	1.189	1.00
7_C	116_A	1.175	1.00
51_L	117_L	1.155	1.00
95_R	98_R	1.151	1.00
49_L	113_L	1.136	1.00
33_L	38_R	1.090	1.00
16_L	52_T	1.076	1.00
94_R	98_R	1.072	1.00
18_D	50_R	1.068	1.00
49_L	114_L	1.057	1.00
35_D	72_G	1.053	1.00
81_Y	101_L	1.031	1.00
79_P	82_Q	1.015	1.00
47_M	66_M	1.014	1.00
94_R	97_V	1.010	1.00
26_T	43_P	1.009	1.00
50_R	65_V	0.986	1.00
77_I	81_Y	0.985	1.00
21_G	113_L	0.985	1.00
64_A	110_L	0.976	1.00
77_I	80_A	0.976	1.00
4_R	8_D	0.957	1.00
72_G	75_P	0.954	1.00
49_L	110_L	0.946	1.00
13_D	16_L	0.945	1.00
94_R	115_R	0.942	1.00
4_R	26_T	0.932	1.00
64_A	78_A	0.929	1.00
12_R	16_L	0.928	1.00
42_E	68_A	0.920	1.00
97_V	111_T	0.907	1.00
12_R	52_T	0.906	1.00
80_A	105_R	0.895	1.00
19_I	121_A	0.889	1.00
63_E	82_Q	0.887	1.00
62_A	82_Q	0.887	1.00
65_V	78_A	0.872	1.00
7_C	120_A	0.871	1.00
26_T	41_G	0.864	1.00
43_P	68_A	0.858	1.00
93_F	118_A	0.855	1.00
17_W	55_D	0.852	1.00
22_H	67_D	0.847	1.00
9_G	19_I	0.834	1.00
112_E	119_T	0.832	1.00
102_G	105_R	0.823	1.00
38_R	44_V	0.821	1.00
31_F	38_R	0.819	1.00
64_A	81_Y	0.816	1.00
102_G	106_G	0.815	1.00
113_L	116_A	0.798	1.00
62_A	101_L	0.796	1.00
24_T	43_P	0.781	1.00
93_F	114_L	0.776	1.00
80_A	106_G	0.775	1.00
114_L	117_L	0.769	1.00
73_E	76_E	0.767	1.00
84_L	87_L	0.765	1.00
111_T	115_R	0.744	1.00
31_F	44_V	0.733	1.00
35_D	73_E	0.732	1.00
12_R	15_G	0.722	1.00
18_D	53_V	0.722	1.00
98_R	111_T	0.717	1.00
28_T	41_G	0.716	1.00
77_I	101_L	0.714	1.00
67_D	70_P	0.683	0.99
27_K	71_Y	0.676	0.99
69_L	78_A	0.676	0.99
27_K	31_F	0.673	0.99
20_E	48_W	0.671	0.99
89_I	118_A	0.668	0.99
76_E	79_P	0.666	0.99
19_I	53_V	0.660	0.99
98_R	115_R	0.658	0.99
5_I	9_G	0.654	0.99
83_R	101_L	0.652	0.99
11_R	55_D	0.649	0.99
53_V	121_A	0.643	0.99
116_A	119_T	0.640	0.99
10_Y	18_D	0.635	0.99
62_A	85_V	0.633	0.99
89_I	121_A	0.628	0.99
33_L	37_E	0.626	0.99
9_G	12_R	0.625	0.99
92_G	96_A	0.621	0.99
111_T	116_A	0.615	0.99
21_G	117_L	0.614	0.99
66_M	70_P	0.614	0.99
47_M	110_L	0.613	0.99
5_I	116_A	0.612	0.99
51_L	89_I	0.608	0.99
97_V	115_R	0.603	0.98
97_V	114_L	0.597	0.98
108_T	112_E	0.596	0.98
2_T	26_T	0.595	0.98
87_L	93_F	0.589	0.98
101_L	106_G	0.587	0.98
32_G	38_R	0.583	0.98
10_Y	20_E	0.578	0.98
45_H	70_P	0.575	0.98
74_C	107_C	0.574	0.98
56_D	60_V	0.573	0.98
103_G	106_G	0.573	0.98
4_R	24_T	0.570	0.98
72_G	76_E	0.565	0.98
92_G	99_E	0.563	0.98
92_G	118_A	0.563	0.98
36_G	71_Y	0.558	0.97
32_G	35_D	0.557	0.97
27_K	42_E	0.550	0.97
112_E	116_A	0.546	0.97
7_C	17_W	0.545	0.97
6_R	22_H	0.544	0.97
47_M	69_L	0.544	0.97
80_A	101_L	0.542	0.97
38_R	42_E	0.538	0.97
64_A	77_I	0.537	0.97
15_G	52_T	0.528	0.96
53_V	57_L	0.527	0.96
43_P	46_D	0.527	0.96
16_L	50_R	0.525	0.96
90_G	122_F	0.524	0.96
21_G	51_L	0.521	0.96
29_Y	36_G	0.520	0.96
10_Y	14_D	0.519	0.96
81_Y	106_G	0.519	0.96
118_A	122_F	0.519	0.96
91_P	96_A	0.519	0.96
33_L	39_P	0.517	0.96
26_T	40_A	0.517	0.96
69_L	73_E	0.516	0.96
23_L	44_V	0.513	0.96
66_M	110_L	0.512	0.96
90_G	94_R	0.512	0.96
23_L	110_L	0.511	0.96
35_D	69_L	0.500	0.95
108_T	111_T	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1atiA	2	0.3821	11.2	0.92	Contact Map
1a3qA	2	0.561	4.8	0.932	Contact Map
2cs4A	1	0.6098	3.5	0.936	Contact Map
3cnxA	2	0.2358	3.5	0.937	Contact Map
4nq3A	4	0.4878	3.3	0.937	Contact Map
2idbA	3	0.9106	2.9	0.939	Contact Map
2uwqA	1	0.6016	2.9	0.939	Contact Map
3f7sA	2	0.3333	2.6	0.94	Contact Map
3hugB	2	0.4065	2.6	0.94	Contact Map
2gj4A	2	0.374	2.4	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.