DUF2750 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2750 - Protein of unknown function (DUF2750)

PFAM:	PF11042	Sequences: YEYFIKEVADTEEVWGLRDEDGWALSEDDEGEDVLPFWSSKEFAEACAKGEWAGYEPVEISLDEFLERWLPGLEEDGLLVGVNWNPDLEGLEVEPEELLEDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (100)
Sequences:	3265 (2593)
Seq/√Len:	259.3
META:	0.782

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_E	59_E	3.563	1.00
16_G	23_W	3.373	1.00
41_K	45_E	3.270	1.00
15_W	57_P	2.669	1.00
37_F	65_F	2.404	1.00
74_E	96_E	2.402	1.00
18_R	58_V	2.325	1.00
39_S	83_N	2.167	1.00
24_A	55_Y	2.139	1.00
14_V	65_F	2.017	1.00
3_Y	43_F	1.868	1.00
40_S	43_F	1.864	1.00
4_F	8_V	1.826	1.00
17_L	48_A	1.809	1.00
25_L	33_D	1.621	1.00
61_S	64_E	1.593	1.00
7_E	40_S	1.557	1.00
2_E	6_K	1.520	1.00
43_F	83_N	1.497	1.00
69_W	72_G	1.424	1.00
28_D	32_E	1.378	1.00
72_G	76_D	1.329	1.00
66_L	99_L	1.317	1.00
41_K	59_E	1.295	1.00
48_A	57_P	1.240	1.00
97_E	101_D	1.211	1.00
47_C	52_W	1.204	1.00
37_F	80_V	1.196	1.00
14_V	70_L	1.186	1.00
81_G	84_W	1.185	1.00
34_V	81_G	1.183	1.00
3_Y	83_N	1.179	1.00
45_E	57_P	1.151	1.00
68_R	72_G	1.144	1.00
69_W	76_D	1.129	1.00
7_E	83_N	1.120	1.00
7_E	43_F	1.119	1.00
62_L	66_L	1.111	1.00
64_E	68_R	1.107	1.00
4_F	37_F	1.105	1.00
85_N	88_L	1.098	1.00
85_N	89_E	1.092	1.00
63_D	67_E	1.084	1.00
7_E	11_T	1.080	1.00
4_F	98_L	1.079	1.00
4_F	82_V	1.071	1.00
44_A	48_A	1.066	1.00
26_S	29_D	1.057	1.00
39_S	43_F	1.046	1.00
19_D	22_G	1.035	1.00
65_F	70_L	1.033	1.00
9_A	62_L	1.032	1.00
74_E	94_E	1.024	1.00
23_W	58_V	1.015	1.00
3_Y	6_K	0.998	1.00
33_D	78_L	0.997	1.00
42_E	45_E	0.952	1.00
5_I	98_L	0.938	1.00
70_L	99_L	0.930	1.00
80_V	98_L	0.926	1.00
16_G	60_I	0.920	1.00
97_E	100_E	0.909	1.00
3_Y	7_E	0.906	1.00
69_W	73_L	0.903	1.00
18_R	23_W	0.897	1.00
44_A	57_P	0.895	1.00
81_G	90_G	0.893	1.00
42_E	46_A	0.893	1.00
7_E	10_D	0.890	1.00
24_A	52_W	0.868	1.00
73_L	78_L	0.852	0.99
13_E	41_K	0.852	0.99
50_G	53_A	0.850	0.99
29_D	32_E	0.846	0.99
17_L	44_A	0.833	0.99
32_E	79_L	0.825	0.99
60_I	69_W	0.824	0.99
82_V	98_L	0.813	0.99
7_E	39_S	0.806	0.99
3_Y	39_S	0.804	0.99
84_W	92_E	0.791	0.99
8_V	98_L	0.791	0.99
96_E	100_E	0.790	0.99
11_T	40_S	0.789	0.99
12_E	63_D	0.783	0.99
94_E	97_E	0.782	0.99
73_L	80_V	0.781	0.99
6_K	9_A	0.774	0.99
16_G	35_L	0.771	0.99
70_L	74_E	0.770	0.99
35_L	73_L	0.763	0.99
19_D	55_Y	0.762	0.99
70_L	95_P	0.754	0.99
16_G	37_F	0.740	0.99
79_L	94_E	0.736	0.99
80_V	95_P	0.730	0.98
82_V	101_D	0.728	0.98
36_P	84_W	0.727	0.98
52_W	55_Y	0.720	0.98
81_G	92_E	0.717	0.98
32_E	94_E	0.708	0.98
48_A	54_G	0.703	0.98
34_V	92_E	0.702	0.98
65_F	69_W	0.700	0.98
4_F	14_V	0.692	0.98
8_V	62_L	0.689	0.98
20_E	56_E	0.684	0.98
17_L	52_W	0.682	0.98
45_E	48_A	0.680	0.98
95_P	98_L	0.677	0.97
18_R	56_E	0.668	0.97
46_A	86_P	0.660	0.97
88_L	92_E	0.650	0.97
73_L	95_P	0.648	0.97
93_V	98_L	0.643	0.97
15_W	41_K	0.642	0.96
32_E	77_G	0.641	0.96
71_P	99_L	0.632	0.96
34_V	84_W	0.632	0.96
61_S	77_G	0.614	0.95
93_V	101_D	0.609	0.95
26_S	84_W	0.608	0.95
6_K	11_T	0.606	0.95
3_Y	10_D	0.605	0.95
13_E	61_S	0.605	0.95
2_E	101_D	0.602	0.95
5_I	101_D	0.601	0.95
43_F	46_A	0.599	0.95
3_Y	42_E	0.597	0.95
26_S	81_G	0.592	0.95
89_E	92_E	0.592	0.95
37_F	70_L	0.587	0.94
26_S	33_D	0.570	0.93
65_F	98_L	0.559	0.93
30_E	87_D	0.555	0.92
25_L	55_Y	0.554	0.92
85_N	90_G	0.552	0.92
94_E	100_E	0.551	0.92
26_S	92_E	0.551	0.92
96_E	99_L	0.547	0.92
49_K	52_W	0.544	0.92
27_E	33_D	0.539	0.91
66_L	70_L	0.537	0.91
16_G	24_A	0.528	0.90
47_C	65_F	0.512	0.89
41_K	57_P	0.510	0.89
12_E	62_L	0.508	0.89
6_K	10_D	0.502	0.88
35_L	69_W	0.501	0.88
37_F	84_W	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4e6zA	1	0.8725	16	0.886	Contact Map
1wspA	3	0.3922	11.1	0.894	Contact Map
1hksA	1	0.4314	10.5	0.895	Contact Map
4ev1A	2	0.9608	9.8	0.896	Contact Map
3pz7A	1	0.3824	9	0.898	Contact Map
3htsB	2	0.4216	7.9	0.9	Contact Map
3syjA	2	0.1667	7.2	0.902	Contact Map
1vjlA	2	0.8725	7.2	0.902	Contact Map
4muqA	1	0.3824	5.8	0.907	Contact Map
2lduA	1	0.5588	5.6	0.907	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.