DUF2844 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2844 - Protein of unknown function (DUF2844)

PFAM:	PF11005	Sequences: AFAALGGDAASVQADQARLKATLRVTSAAGYTVHEITLPSGTVVREYVSPAGKVFAVAWQGPFMPDLRQLLGSYFDQYQAAAQAARAARRGGRRPLRIQTPDLVVESGGHMRAFSGRAYLPSLLPAGVSADDI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	133 (130)
Sequences:	2583 (2023)
Seq/√Len:	177.4
META:	0.923

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
120_L	123_L	4.600	1.00
106_E	117_R	4.316	1.00
13_Q	16_Q	3.713	1.00
4_A	7_G	3.050	1.00
21_A	36_I	3.004	1.00
35_E	45_R	2.771	1.00
102_D	122_S	2.649	1.00
101_P	121_P	2.516	1.00
77_Q	100_T	2.415	1.00
124_L	130_A	2.177	1.00
12_V	15_D	2.150	1.00
31_Y	55_F	2.135	1.00
97_R	106_E	2.043	1.00
7_G	73_S	1.872	1.00
68_R	76_D	1.787	1.00
64_M	107_S	1.778	1.00
74_Y	77_Q	1.753	1.00
11_S	15_D	1.750	1.00
110_H	114_F	1.726	1.00
25_V	34_H	1.723	1.00
77_Q	102_D	1.710	1.00
78_Y	105_V	1.674	1.00
92_G	95_P	1.626	1.00
43_V	60_Q	1.620	1.00
64_M	114_F	1.609	1.00
104_V	119_Y	1.543	1.00
33_V	45_R	1.542	1.00
15_D	19_L	1.524	1.00
45_R	58_A	1.480	1.00
99_Q	106_E	1.456	1.00
16_Q	23_L	1.428	1.00
56_A	130_A	1.427	1.00
42_T	61_G	1.421	1.00
91_G	94_R	1.419	1.00
76_D	79_Q	1.415	1.00
38_L	42_T	1.389	1.00
48_V	54_V	1.387	1.00
68_R	75_F	1.349	1.00
15_D	36_I	1.338	1.00
129_S	132_D	1.337	1.00
82_A	96_L	1.316	1.00
49_S	123_L	1.312	1.00
74_Y	120_L	1.282	1.00
34_H	48_V	1.260	1.00
66_D	69_Q	1.255	1.00
59_W	116_G	1.236	1.00
108_G	115_S	1.219	1.00
107_S	114_F	1.191	1.00
9_A	32_T	1.173	1.00
9_A	13_Q	1.147	1.00
45_R	60_Q	1.134	1.00
56_A	128_V	1.132	1.00
24_R	35_E	1.126	1.00
12_V	19_L	1.093	1.00
110_H	113_A	1.091	1.00
4_A	72_G	1.081	1.00
109_G	113_A	1.056	1.00
32_T	50_P	1.034	0.99
35_E	43_V	1.024	0.99
23_L	26_T	1.019	0.99
30_G	50_P	1.013	0.99
108_G	111_M	1.000	0.99
124_L	129_S	0.998	0.99
25_V	32_T	0.993	0.99
78_Y	82_A	0.950	0.99
76_D	80_A	0.940	0.99
36_I	46_E	0.921	0.99
93_R	96_L	0.914	0.99
62_P	114_F	0.914	0.99
17_A	20_K	0.907	0.99
7_G	72_G	0.907	0.99
17_A	22_T	0.904	0.99
18_R	66_D	0.899	0.99
31_Y	132_D	0.894	0.99
9_A	12_V	0.891	0.98
16_Q	19_L	0.887	0.98
61_G	112_R	0.886	0.98
22_T	25_V	0.885	0.98
75_F	79_Q	0.873	0.98
8_D	53_K	0.869	0.98
44_V	70_L	0.854	0.98
30_G	132_D	0.852	0.98
30_G	127_G	0.839	0.98
31_Y	119_Y	0.831	0.98
42_T	62_P	0.829	0.98
102_D	121_P	0.824	0.97
102_D	120_L	0.798	0.97
95_P	108_G	0.795	0.97
22_T	26_T	0.790	0.97
63_F	111_M	0.788	0.97
124_L	128_V	0.788	0.97
99_Q	119_Y	0.784	0.97
99_Q	121_P	0.763	0.96
3_A	6_G	0.758	0.96
124_L	127_G	0.757	0.96
24_R	37_T	0.754	0.96
104_V	121_P	0.742	0.95
98_I	103_L	0.742	0.95
32_T	93_R	0.739	0.95
30_G	128_V	0.739	0.95
83_Q	131_D	0.737	0.95
66_D	126_A	0.733	0.95
77_Q	120_L	0.732	0.95
117_R	131_D	0.731	0.95
76_D	90_R	0.728	0.95
91_G	95_P	0.727	0.95
62_P	112_R	0.726	0.95
82_A	93_R	0.725	0.95
23_L	28_A	0.723	0.95
47_Y	113_A	0.715	0.94
42_T	63_F	0.713	0.94
33_V	55_F	0.712	0.94
90_R	94_R	0.711	0.94
123_L	132_D	0.711	0.94
63_F	68_R	0.707	0.94
34_H	69_Q	0.702	0.94
11_S	49_S	0.702	0.94
13_Q	22_T	0.699	0.94
9_A	48_V	0.696	0.94
4_A	54_V	0.691	0.93
80_A	89_R	0.688	0.93
12_V	18_R	0.687	0.93
102_D	107_S	0.684	0.93
66_D	114_F	0.678	0.93
2_F	10_A	0.673	0.92
51_A	54_V	0.670	0.92
15_D	69_Q	0.669	0.92
36_I	70_L	0.662	0.92
63_F	114_F	0.658	0.91
11_S	19_L	0.649	0.91
109_G	114_F	0.648	0.91
8_D	12_V	0.643	0.91
50_P	128_V	0.640	0.90
57_V	71_L	0.634	0.90
1_A	5_L	0.631	0.90
6_G	74_Y	0.630	0.90
57_V	61_G	0.629	0.90
36_I	69_Q	0.623	0.89
60_Q	113_A	0.620	0.89
27_S	32_T	0.620	0.89
98_I	105_V	0.615	0.88
41_G	124_L	0.614	0.88
16_Q	79_Q	0.613	0.88
99_Q	130_A	0.608	0.88
22_T	29_A	0.608	0.88
17_A	27_S	0.603	0.88
46_E	60_Q	0.600	0.87
66_D	102_D	0.598	0.87
71_L	75_F	0.597	0.87
53_K	123_L	0.588	0.86
67_L	71_L	0.585	0.86
71_L	92_G	0.582	0.86
20_K	25_V	0.582	0.86
12_V	36_I	0.580	0.85
37_T	40_S	0.579	0.85
60_Q	115_S	0.579	0.85
10_A	18_R	0.577	0.85
29_A	73_S	0.575	0.85
110_H	119_Y	0.575	0.85
108_G	114_F	0.567	0.84
13_Q	23_L	0.566	0.84
119_Y	122_S	0.562	0.84
73_S	84_A	0.560	0.83
7_G	101_P	0.559	0.83
77_Q	82_A	0.558	0.83
58_A	117_R	0.557	0.83
15_D	20_K	0.555	0.83
9_A	19_L	0.554	0.83
87_A	94_R	0.553	0.83
47_Y	58_A	0.552	0.83
29_A	54_V	0.550	0.82
70_L	75_F	0.548	0.82
67_L	105_V	0.546	0.82
1_A	105_V	0.545	0.82
21_A	25_V	0.541	0.81
81_A	100_T	0.539	0.81
111_M	114_F	0.539	0.81
25_V	29_A	0.537	0.81
40_S	63_F	0.537	0.81
60_Q	91_G	0.536	0.81
33_V	39_P	0.534	0.80
20_K	23_L	0.532	0.80
37_T	43_V	0.531	0.80
79_Q	92_G	0.531	0.80
44_V	116_G	0.531	0.80
13_Q	19_L	0.529	0.80
57_V	70_L	0.529	0.80
126_A	130_A	0.524	0.79
44_V	61_G	0.522	0.79
14_A	19_L	0.520	0.79
46_E	95_P	0.513	0.78
13_Q	18_R	0.511	0.78
39_P	81_A	0.508	0.77
103_L	120_L	0.500	0.76
53_K	126_A	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vjkA	1	0.2556	6.4	0.944	Contact Map
4wijA	2	0.6992	4.5	0.948	Contact Map
2gkpA	1	0.3759	4.4	0.948	Contact Map
4irfA	1	0.4211	4.3	0.949	Contact Map
2q5wD	1	0.2331	4.2	0.949	Contact Map
3ttyA	4	0.9699	4	0.949	Contact Map
4hroA	1	0.2556	3.3	0.952	Contact Map
2g1eA	1	0.2256	2.9	0.953	Contact Map
1i7fA	2	0.7444	2.4	0.955	Contact Map
3c75L	1	0.0226	2	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.