DUF2802 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2802 - Protein of unknown function (DUF2802)

PFAM:	PF10975	Sequences: GMGQRLAELEQRLARLEERLEELEARDPSSRSYSQAIRLARQGASVEELAESCGLSRAEAELLLRLHR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	68 (66)
Sequences:	2610 (1846)
Seq/√Len:	227.2
META:	0.86

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_R	10_E	3.437	1.00
45_S	48_E	3.199	1.00
40_A	49_L	2.633	1.00
37_I	67_H	2.482	1.00
40_A	64_L	2.123	1.00
20_L	23_L	2.110	1.00
49_L	60_A	2.099	1.00
62_L	66_L	2.056	1.00
57_R	61_E	1.850	1.00
37_I	41_R	1.776	1.00
39_L	53_C	1.689	1.00
46_V	61_E	1.597	1.00
44_A	48_E	1.579	1.00
7_A	11_Q	1.554	1.00
19_R	24_E	1.507	1.00
14_A	18_E	1.481	1.00
55_L	60_A	1.437	1.00
53_C	60_A	1.398	1.00
17_E	21_E	1.289	1.00
47_E	57_R	1.225	1.00
12_R	17_E	1.202	1.00
36_A	55_L	1.202	1.00
19_R	23_L	1.162	1.00
24_E	27_D	1.102	1.00
18_E	21_E	1.087	1.00
4_Q	8_E	1.083	1.00
16_L	20_L	1.054	1.00
8_E	11_Q	1.052	1.00
32_S	56_S	1.030	1.00
47_E	51_E	1.025	1.00
40_A	60_A	1.020	1.00
16_L	23_L	1.017	1.00
15_R	18_E	0.989	1.00
4_Q	7_A	0.979	1.00
36_A	53_C	0.976	1.00
42_Q	52_S	0.975	1.00
3_G	7_A	0.974	1.00
44_A	50_A	0.956	1.00
44_A	52_S	0.930	1.00
38_R	42_Q	0.918	1.00
10_E	14_A	0.916	1.00
14_A	20_L	0.886	0.99
7_A	10_E	0.885	0.99
58_A	61_E	0.875	0.99
35_Q	38_R	0.857	0.99
58_A	65_R	0.840	0.99
50_A	57_R	0.832	0.99
33_Y	63_L	0.816	0.99
41_R	67_H	0.814	0.99
59_E	62_L	0.797	0.99
12_R	15_R	0.782	0.98
46_V	57_R	0.779	0.98
32_S	65_R	0.776	0.98
8_E	12_R	0.769	0.98
44_A	60_A	0.743	0.98
34_S	51_E	0.742	0.98
35_Q	42_Q	0.742	0.98
35_Q	58_A	0.742	0.98
8_E	17_E	0.720	0.97
40_A	63_L	0.716	0.97
59_E	66_L	0.710	0.97
7_A	12_R	0.701	0.97
49_L	53_C	0.700	0.97
25_A	28_P	0.699	0.97
33_Y	65_R	0.699	0.97
49_L	64_L	0.693	0.97
33_Y	53_C	0.685	0.96
9_L	13_L	0.677	0.96
31_R	63_L	0.676	0.96
9_L	16_L	0.675	0.96
17_E	20_L	0.665	0.96
4_Q	15_R	0.655	0.95
29_S	41_R	0.653	0.95
32_S	38_R	0.645	0.95
36_A	60_A	0.642	0.95
31_R	34_S	0.641	0.95
39_L	61_E	0.638	0.95
48_E	52_S	0.625	0.94
5_R	12_R	0.610	0.93
28_P	51_E	0.604	0.93
54_G	63_L	0.603	0.93
29_S	54_G	0.596	0.93
4_Q	14_A	0.593	0.92
18_E	26_R	0.583	0.92
35_Q	52_S	0.582	0.92
14_A	23_L	0.559	0.90
36_A	40_A	0.558	0.90
22_E	58_A	0.553	0.90
9_L	20_L	0.553	0.90
15_R	19_R	0.541	0.88
27_D	31_R	0.536	0.88
3_G	10_E	0.535	0.88
46_V	64_L	0.531	0.88
50_A	60_A	0.524	0.87
20_L	25_A	0.524	0.87
4_Q	12_R	0.523	0.87
38_R	41_R	0.516	0.86
33_Y	66_L	0.511	0.86
14_A	21_E	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sfuA	1	0.6471	47.9	0.773	Contact Map
4wszA	2	0.6618	43.8	0.779	Contact Map
2jpcA	1	0.5588	42	0.782	Contact Map
3iuoA	4	0.6912	40.6	0.783	Contact Map
2x48A	1	0.7941	38.1	0.786	Contact Map
1tc3C	1	0.6765	37.8	0.787	Contact Map
3ugoA	1	0.1324	37.1	0.788	Contact Map
1ttyA	1	0.8529	36.3	0.789	Contact Map
3t72q	1	0.8676	36.3	0.789	Contact Map
3qp6A	2	1	34.3	0.791	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.