DUF2799 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2799 - Protein of unknown function (DUF2799)

PFAM:	PF10973	Sequences: DWYAIGYEDGAAGRPASRLGEHRKACAKHGVTPDLAAYQAGREEGLREYCTPENGFRLGRSGRSYNGVCPADLEAAFLAAYQAGRQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (85)
Sequences:	3111 (2461)
Seq/√Len:	266.9
META:	0.847

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_R	46_L	3.857	1.00
34_D	37_A	2.547	1.00
49_Y	58_L	2.436	1.00
22_H	25_A	2.424	1.00
14_R	18_R	2.323	1.00
19_L	33_P	2.263	1.00
52_P	80_A	2.101	1.00
9_D	38_Y	2.077	1.00
35_L	39_Q	2.059	1.00
74_E	78_L	1.977	1.00
1_D	4_A	1.948	1.00
54_N	58_L	1.793	1.00
55_G	77_F	1.767	1.00
58_L	63_R	1.693	1.00
3_Y	44_E	1.664	1.00
55_G	80_A	1.660	1.00
7_Y	11_A	1.648	1.00
10_G	68_V	1.634	1.00
18_R	21_E	1.627	1.00
70_P	73_L	1.620	1.00
65_Y	74_E	1.585	1.00
19_L	35_L	1.543	1.00
39_Q	43_E	1.434	1.00
18_R	22_H	1.359	1.00
47_R	72_D	1.295	1.00
82_Q	85_R	1.288	1.00
57_R	61_S	1.275	1.00
41_G	45_G	1.271	1.00
37_A	40_A	1.240	1.00
4_A	7_Y	1.212	1.00
46_L	68_V	1.206	1.00
7_Y	48_E	1.196	1.00
54_N	57_R	1.176	1.00
4_A	8_E	1.169	1.00
23_R	35_L	1.152	1.00
3_Y	7_Y	1.131	1.00
5_I	22_H	1.111	1.00
79_A	83_A	1.101	1.00
80_A	83_A	1.069	1.00
40_A	44_E	1.060	1.00
3_Y	41_G	1.049	1.00
10_G	42_R	1.005	1.00
20_G	23_R	0.991	1.00
78_L	82_Q	0.989	1.00
16_A	39_Q	0.973	1.00
21_E	24_K	0.973	1.00
3_Y	40_A	0.954	1.00
52_P	56_F	0.943	1.00
81_Y	85_R	0.940	1.00
80_A	84_G	0.920	1.00
3_Y	37_A	0.916	1.00
56_F	60_R	0.906	1.00
65_Y	77_F	0.895	1.00
8_E	23_R	0.881	1.00
9_D	22_H	0.877	1.00
74_E	77_F	0.876	1.00
17_S	20_G	0.861	1.00
47_R	73_L	0.859	1.00
11_A	48_E	0.854	1.00
22_H	33_P	0.852	1.00
76_A	79_A	0.842	1.00
36_A	39_Q	0.832	0.99
44_E	47_R	0.827	0.99
36_A	40_A	0.822	0.99
71_A	74_E	0.804	0.99
65_Y	78_L	0.802	0.99
52_P	55_G	0.800	0.99
59_G	84_G	0.798	0.99
16_A	42_R	0.791	0.99
51_T	55_G	0.790	0.99
56_F	84_G	0.778	0.99
16_A	48_E	0.772	0.99
39_Q	42_R	0.762	0.99
42_R	68_V	0.730	0.99
49_Y	68_V	0.730	0.99
73_L	76_A	0.723	0.98
55_G	59_G	0.722	0.98
10_G	46_L	0.697	0.98
67_G	77_F	0.696	0.98
62_G	82_Q	0.687	0.98
5_I	9_D	0.682	0.98
51_T	54_N	0.677	0.98
64_S	81_Y	0.670	0.98
19_L	23_R	0.666	0.97
19_L	22_H	0.662	0.97
50_C	69_C	0.656	0.97
8_E	11_A	0.655	0.97
28_K	31_V	0.651	0.97
8_E	35_L	0.650	0.97
67_G	74_E	0.645	0.97
58_L	77_F	0.633	0.97
56_F	83_A	0.628	0.96
78_L	81_Y	0.628	0.96
18_R	38_Y	0.612	0.96
24_K	27_A	0.609	0.96
79_A	82_Q	0.608	0.96
29_H	33_P	0.607	0.96
6_G	41_G	0.607	0.96
7_Y	44_E	0.606	0.96
10_G	49_Y	0.598	0.95
16_A	20_G	0.595	0.95
44_E	48_E	0.595	0.95
8_E	12_A	0.592	0.95
59_G	65_Y	0.589	0.95
2_W	6_G	0.589	0.95
14_R	22_H	0.587	0.95
6_G	10_G	0.586	0.95
49_Y	54_N	0.577	0.94
55_G	65_Y	0.571	0.94
38_Y	77_F	0.570	0.94
58_L	61_S	0.570	0.94
52_P	76_A	0.551	0.93
4_A	35_L	0.551	0.93
55_G	84_G	0.545	0.92
8_E	20_G	0.545	0.92
56_F	80_A	0.537	0.92
39_Q	44_E	0.535	0.92
38_Y	73_L	0.533	0.91
59_G	62_G	0.525	0.91
46_L	65_Y	0.522	0.91
23_R	27_A	0.520	0.90
15_P	66_N	0.518	0.90
13_G	46_L	0.518	0.90
24_K	31_V	0.514	0.90
76_A	80_A	0.505	0.89
20_G	39_Q	0.502	0.89
45_G	49_Y	0.502	0.89
7_Y	10_G	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3v22V	1	0.5	17.9	0.862	Contact Map
2jrmA	1	0.5233	17.6	0.863	Contact Map
3optA	1	0	1.9	0.913	Contact Map
4pmoA	1	0.8953	1.3	0.921	Contact Map
2ww2A	3	0.9535	1.3	0.922	Contact Map
3qweA	2	0.4651	1.2	0.922	Contact Map
3nrlA	2	0.2209	1.2	0.922	Contact Map
2hh8A	1	0.8023	1.2	0.923	Contact Map
2khfA	1	0.2093	1.2	0.923	Contact Map
4krdB	1	0.5116	1.2	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.