Holin_BhlA - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Holin_BhlA - BhlA holin family

PFAM:	PF10960	Sequences: MEEEILKLALSQGIWAVLFVWLLFYVLKENEKREEKQEEREEKYQEIIDKLTEKLEIVEDIKKDVEEIKN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	70 (69)
Sequences:	656 (528)
Seq/√Len:	63.5
META:	0.668

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_E	7_K	4.262	1.00
9_A	14_I	3.003	1.00
64_D	69_K	2.867	1.00
41_E	44_Y	2.461	1.00
40_R	44_Y	2.378	1.00
9_A	20_V	2.345	1.00
19_F	23_L	2.209	1.00
10_L	17_V	2.108	1.00
43_K	46_E	1.693	0.99
50_K	53_E	1.612	0.99
15_W	19_F	1.609	0.99
37_Q	41_E	1.533	0.99
34_E	37_Q	1.518	0.99
23_L	30_N	1.504	0.98
55_L	58_V	1.441	0.98
54_K	57_I	1.441	0.98
37_Q	40_R	1.355	0.97
19_F	26_V	1.262	0.95
51_L	54_K	1.225	0.95
30_N	34_E	1.197	0.94
46_E	49_D	1.192	0.94
23_L	26_V	1.187	0.94
62_K	66_E	1.169	0.93
26_V	30_N	1.151	0.93
12_Q	29_E	1.147	0.92
44_Y	47_I	1.116	0.91
63_K	66_E	1.088	0.90
43_K	49_D	1.082	0.90
46_E	50_K	1.074	0.90
12_Q	24_F	1.068	0.89
64_D	67_E	1.062	0.89
36_K	39_E	1.054	0.89
44_Y	51_L	1.042	0.88
33_R	37_Q	1.035	0.88
3_E	6_L	0.985	0.85
51_L	58_V	0.965	0.84
2_E	12_Q	0.965	0.84
25_Y	32_K	0.961	0.84
47_I	51_L	0.952	0.83
42_E	46_E	0.938	0.82
21_W	24_F	0.934	0.82
61_I	65_V	0.924	0.81
38_E	44_Y	0.920	0.81
52_T	55_L	0.914	0.81
60_D	63_K	0.911	0.80
45_Q	48_I	0.878	0.78
21_W	25_Y	0.870	0.77
44_Y	48_I	0.867	0.77
58_V	61_I	0.848	0.75
15_W	21_W	0.845	0.75
51_L	55_L	0.832	0.74
38_E	41_E	0.808	0.72
23_L	34_E	0.797	0.71
35_E	39_E	0.795	0.71
5_I	24_F	0.793	0.70
19_F	34_E	0.793	0.70
21_W	27_L	0.761	0.67
33_R	36_K	0.744	0.66
34_E	38_E	0.739	0.65
44_Y	55_L	0.739	0.65
8_L	11_S	0.739	0.65
44_Y	52_T	0.735	0.65
64_D	68_I	0.735	0.65
27_L	30_N	0.735	0.65
54_K	59_E	0.734	0.64
33_R	40_R	0.708	0.62
33_R	41_E	0.706	0.61
4_E	11_S	0.698	0.61
60_D	68_I	0.695	0.60
13_G	23_L	0.694	0.60
35_E	38_E	0.664	0.57
9_A	15_W	0.662	0.57
5_I	46_E	0.661	0.56
58_V	64_D	0.654	0.56
34_E	41_E	0.653	0.56
49_D	66_E	0.646	0.55
14_I	22_L	0.639	0.54
19_F	37_Q	0.633	0.53
48_I	51_L	0.629	0.53
19_F	30_N	0.628	0.53
40_R	45_Q	0.626	0.52
51_L	61_I	0.612	0.51
5_I	56_E	0.595	0.49
48_I	55_L	0.590	0.48
41_E	45_Q	0.584	0.48
11_S	52_T	0.583	0.47
37_Q	44_Y	0.578	0.47
16_A	30_N	0.577	0.47
5_I	9_A	0.574	0.46
35_E	53_E	0.571	0.46
32_K	35_E	0.567	0.46
56_E	63_K	0.562	0.45
34_E	44_Y	0.556	0.44
4_E	8_L	0.554	0.44
9_A	21_W	0.552	0.44
50_K	56_E	0.548	0.43
24_F	30_N	0.543	0.43
11_S	28_K	0.543	0.43
9_A	17_V	0.536	0.42
40_R	48_I	0.510	0.39
8_L	14_I	0.508	0.39
12_Q	30_N	0.506	0.39
45_Q	57_I	0.502	0.38
3_E	7_K	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cbcA	3	0.3857	42.6	0.833	Contact Map
4ltoA	3	1	28.7	0.847	Contact Map
2rddB	1	0.5286	21.5	0.857	Contact Map
3ziaG	1	1	15.9	0.865	Contact Map
2ksdA	1	0.5143	13.3	0.87	Contact Map
2qe7G	1	0.7	10.8	0.875	Contact Map
4pz1A	2	0.6286	10.7	0.875	Contact Map
2xokG	1	1	10.3	0.876	Contact Map
2ck3G	1	0.8429	10	0.876	Contact Map
4h5yA	1	0.9429	9	0.879	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.