DUF2757 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2757 - Protein of unknown function (DUF2757)

PFAM:	PF10955	Sequences: MAIHYVCRHCGTKIGEIEQDSVDEEQLGFHFLTPEERQDIISYDSNGDITVKVICEDCQEALERNPELHELDYFIQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (71)
Sequences:	553 (386)
Seq/√Len:	45.8
META:	0.486

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_I	53_V	3.807	1.00
29_F	51_V	3.487	1.00
59_Q	63_E	3.390	1.00
56_E	59_Q	3.058	1.00
44_D	48_D	2.819	1.00
67_E	70_E	2.571	1.00
4_H	16_E	2.524	1.00
29_F	41_I	2.111	1.00
13_K	16_E	1.895	0.99
33_T	40_I	1.754	0.98
62_L	68_L	1.748	0.98
25_E	30_H	1.666	0.98
68_L	71_L	1.662	0.98
23_D	26_Q	1.596	0.97
33_T	36_E	1.548	0.96
3_I	49_I	1.543	0.96
5_Y	28_G	1.455	0.95
2_A	48_D	1.345	0.92
44_D	52_K	1.263	0.89
7_C	10_C	1.254	0.89
65_N	68_L	1.181	0.86
61_A	65_N	1.146	0.84
31_F	38_Q	1.098	0.82
4_H	13_K	1.085	0.81
6_V	50_T	1.058	0.79
16_E	71_L	1.043	0.78
19_Q	35_E	1.037	0.78
28_G	32_L	1.024	0.77
3_I	22_V	1.011	0.76
9_H	54_I	0.997	0.75
28_G	36_E	0.987	0.74
5_Y	36_E	0.973	0.73
53_V	59_Q	0.963	0.72
8_R	15_G	0.942	0.71
9_H	15_G	0.934	0.70
24_E	37_R	0.930	0.70
5_Y	27_L	0.926	0.69
2_A	16_E	0.921	0.69
17_I	29_F	0.921	0.69
24_E	57_D	0.918	0.69
9_H	43_Y	0.918	0.69
60_E	64_R	0.915	0.68
43_Y	49_I	0.901	0.67
18_E	21_S	0.901	0.67
28_G	37_R	0.849	0.62
3_I	9_H	0.837	0.61
2_A	54_I	0.834	0.61
14_I	31_F	0.830	0.61
5_Y	29_F	0.824	0.60
54_I	59_Q	0.811	0.59
8_R	57_D	0.805	0.58
27_L	32_L	0.792	0.57
15_G	36_E	0.791	0.57
4_H	50_T	0.782	0.56
27_L	37_R	0.757	0.54
33_T	39_D	0.750	0.53
55_C	58_C	0.742	0.52
27_L	43_Y	0.741	0.52
41_I	49_I	0.730	0.51
37_R	67_E	0.725	0.51
2_A	53_V	0.715	0.50
40_I	50_T	0.701	0.48
11_G	53_V	0.684	0.47
26_Q	35_E	0.681	0.46
40_I	70_E	0.676	0.46
28_G	65_N	0.657	0.44
14_I	26_Q	0.651	0.43
33_T	71_L	0.649	0.43
62_L	69_H	0.646	0.43
2_A	51_V	0.646	0.43
62_L	65_N	0.646	0.43
6_V	52_K	0.637	0.42
38_Q	56_E	0.634	0.42
6_V	13_K	0.628	0.41
53_V	61_A	0.624	0.41
18_E	42_S	0.623	0.41
44_D	50_T	0.620	0.40
19_Q	22_V	0.613	0.40
43_Y	62_L	0.604	0.39
15_G	66_P	0.601	0.39
19_Q	26_Q	0.595	0.38
5_Y	32_L	0.586	0.37
21_S	46_N	0.584	0.37
1_M	7_C	0.577	0.36
17_I	37_R	0.575	0.36
11_G	63_E	0.569	0.36
25_E	38_Q	0.567	0.35
44_D	49_I	0.564	0.35
14_I	42_S	0.559	0.35
34_P	42_S	0.557	0.35
9_H	48_D	0.556	0.34
8_R	54_I	0.554	0.34
10_C	58_C	0.551	0.34
10_C	55_C	0.551	0.34
5_Y	10_C	0.549	0.34
24_E	51_V	0.548	0.34
26_Q	67_E	0.539	0.33
13_K	18_E	0.533	0.32
4_H	26_Q	0.527	0.32
59_Q	64_R	0.526	0.32
3_I	34_P	0.521	0.31
23_D	53_V	0.516	0.31
9_H	16_E	0.515	0.31
38_Q	42_S	0.512	0.31
45_S	60_E	0.503	0.30
57_D	64_R	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vq0A	2	0.7632	71	0.852	Contact Map
1i7fA	2	0.1053	70.8	0.852	Contact Map
1vzyA	3	0.7763	62.4	0.86	Contact Map
2xigA	4	0.7237	47.5	0.872	Contact Map
3eyyA	2	0.6447	45.3	0.873	Contact Map
2fe3A	2	0.7368	42.1	0.876	Contact Map
3mwmA	2	0.6974	39.4	0.878	Contact Map
2o03A	2	0.6711	36.6	0.88	Contact Map
1vziA	2	0.8684	36.3	0.88	Contact Map
1y07A	3	0.8684	33.7	0.883	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.004 seconds.