DUF2631 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2631 - Protein of unknown function (DUF2631)

PFAM:	PF10939	Sequences: ASTEVERHTGTTVDPADVPSAEWGWSGENPRTWRIAGWFSALFLLAMLIGNHVGHVEDIWLIGFAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	66 (63)
Sequences:	676 (343)
Seq/√Len:	43.2
META:	0.661

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_L	46_A	4.361	1.00
18_V	26_S	4.208	1.00
55_H	58_D	3.677	1.00
45_L	65_A	3.027	1.00
47_M	61_L	2.359	1.00
52_H	57_E	1.915	0.99
39_F	43_F	1.907	0.99
38_W	41_A	1.798	0.98
51_N	57_E	1.784	0.98
60_W	64_F	1.732	0.98
50_G	57_E	1.617	0.97
36_A	40_S	1.566	0.96
22_E	30_P	1.395	0.92
48_L	62_I	1.383	0.92
44_L	65_A	1.356	0.91
28_E	33_W	1.334	0.91
18_V	23_W	1.280	0.89
5_V	8_H	1.270	0.88
38_W	42_L	1.259	0.88
54_G	59_I	1.197	0.85
59_I	63_G	1.122	0.81
50_G	54_G	1.064	0.77
35_I	39_F	1.029	0.75
51_N	54_G	1.020	0.74
43_F	47_M	1.014	0.74
33_W	40_S	1.012	0.74
3_T	6_E	0.928	0.67
27_G	30_P	0.922	0.67
60_W	63_G	0.920	0.66
58_D	62_I	0.907	0.65
28_E	32_T	0.905	0.65
3_T	10_G	0.891	0.64
18_V	21_A	0.885	0.63
16_A	32_T	0.879	0.63
48_L	58_D	0.876	0.63
9_T	23_W	0.861	0.61
52_H	55_H	0.860	0.61
26_S	29_N	0.838	0.59
51_N	58_D	0.836	0.59
15_P	21_A	0.832	0.58
22_E	32_T	0.831	0.58
41_A	46_A	0.817	0.57
34_R	41_A	0.808	0.56
9_T	22_E	0.801	0.56
56_V	59_I	0.797	0.55
50_G	58_D	0.780	0.54
4_E	14_D	0.777	0.53
35_I	38_W	0.769	0.53
29_N	33_W	0.761	0.52
3_T	16_A	0.759	0.52
52_H	58_D	0.758	0.52
34_R	38_W	0.755	0.51
51_N	61_L	0.744	0.50
54_G	57_E	0.739	0.50
23_W	31_R	0.738	0.50
5_V	9_T	0.724	0.48
44_L	64_F	0.716	0.48
42_L	63_G	0.705	0.46
41_A	44_L	0.696	0.46
56_V	60_W	0.694	0.45
3_T	9_T	0.693	0.45
2_S	36_A	0.675	0.44
50_G	56_V	0.672	0.43
55_H	59_I	0.659	0.42
45_L	52_H	0.655	0.42
36_A	39_F	0.650	0.41
15_P	22_E	0.644	0.41
6_E	23_W	0.631	0.40
7_R	14_D	0.620	0.39
18_V	29_N	0.615	0.38
51_N	56_V	0.612	0.38
53_V	57_E	0.612	0.38
39_F	42_L	0.595	0.36
43_F	46_A	0.593	0.36
32_T	36_A	0.590	0.36
23_W	37_G	0.585	0.35
4_E	31_R	0.583	0.35
15_P	20_S	0.576	0.35
7_R	10_G	0.572	0.34
21_A	26_S	0.568	0.34
15_P	39_F	0.563	0.34
13_V	21_A	0.551	0.33
13_V	17_D	0.549	0.32
7_R	22_E	0.538	0.31
20_S	26_S	0.533	0.31
5_V	10_G	0.533	0.31
49_I	53_V	0.529	0.31
8_H	28_E	0.529	0.31
18_V	37_G	0.523	0.30
15_P	19_P	0.520	0.30
15_P	29_N	0.519	0.30
34_R	37_G	0.514	0.30
17_D	66_A	0.504	0.29
10_G	13_V	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bs2C	2	0.9242	4.7	0.921	Contact Map
1z1nX	1	0.1818	2.9	0.929	Contact Map
1fftB	1	0.2424	2.8	0.929	Contact Map
3v2yA	1	0.9545	2.5	0.931	Contact Map
3vpgA	3	0.8939	2.4	0.932	Contact Map
2cvcA	1	0.197	2.2	0.934	Contact Map
1hfoA	3	0.4545	2.1	0.934	Contact Map
3kanA	3	0.5	2.1	0.934	Contact Map
1mwwA	3	0.5152	2.1	0.935	Contact Map
2e84A	1	0.1818	2	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.