DUF2637 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2637 - Protein of unknown function (DUF2637)

PFAM:	PF10935	Sequences: WAAAAGVALLAAAAFALSYAALRDLARAAGVPGALAWLFPLIVDGGIVVAALLALALARAGRPARRARLLAWALAAASVAANVAHAWAAVVAAAPPVAAPVLFELLLAAVRRAALRRAGLAAARAPRLAAARWLLAPLATLAAWRRAVLMRLWEIRSYEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	160 (144)
Sequences:	1611 (1156)
Seq/√Len:	96.3
META:	0.673

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
96_P	100_P	3.092	1.00
135_L	145_R	2.946	1.00
136_A	139_A	2.851	1.00
19_Y	37_W	2.801	1.00
13_A	38_L	2.423	1.00
78_S	82_N	2.397	1.00
18_S	44_D	2.369	1.00
96_P	99_A	2.339	1.00
44_D	78_S	2.307	1.00
6_G	49_V	2.229	1.00
129_A	133_W	1.945	1.00
133_W	140_T	1.838	1.00
46_G	50_A	1.776	1.00
143_A	146_R	1.769	1.00
46_G	74_L	1.714	1.00
13_A	42_I	1.711	1.00
21_A	31_V	1.687	1.00
71_A	74_L	1.644	1.00
22_L	81_A	1.642	1.00
32_P	35_L	1.638	1.00
95_P	100_P	1.615	1.00
138_L	142_A	1.613	1.00
139_A	142_A	1.588	1.00
128_L	133_W	1.577	1.00
80_A	83_V	1.566	1.00
80_A	84_A	1.562	1.00
96_P	104_E	1.542	1.00
104_E	108_A	1.533	1.00
16_A	35_L	1.512	1.00
22_L	26_A	1.510	1.00
26_A	39_F	1.503	1.00
96_P	103_F	1.476	1.00
16_A	25_L	1.463	1.00
112_R	115_L	1.458	1.00
99_A	103_F	1.417	1.00
92_A	100_P	1.397	0.99
23_R	27_R	1.382	0.99
116_R	119_G	1.356	0.99
25_L	30_G	1.331	0.99
93_A	96_P	1.317	0.99
15_F	75_A	1.301	0.99
141_L	144_W	1.300	0.99
137_P	143_A	1.293	0.99
140_T	143_A	1.278	0.99
23_R	37_W	1.277	0.99
95_P	99_A	1.274	0.99
89_A	92_A	1.267	0.99
92_A	99_A	1.265	0.99
100_P	104_E	1.262	0.99
17_L	22_L	1.262	0.99
11_A	19_Y	1.199	0.98
19_Y	40_P	1.198	0.98
68_R	72_W	1.192	0.98
137_P	140_T	1.189	0.98
6_G	52_L	1.178	0.98
100_P	103_F	1.176	0.98
44_D	103_F	1.173	0.98
14_A	42_I	1.171	0.98
100_P	108_A	1.167	0.98
92_A	104_E	1.145	0.98
127_R	130_A	1.129	0.98
140_T	144_W	1.119	0.97
79_V	83_V	1.119	0.97
15_F	47_I	1.115	0.97
136_A	140_T	1.099	0.97
126_P	132_R	1.089	0.97
116_R	120_L	1.081	0.97
92_A	95_P	1.077	0.97
114_A	118_A	1.070	0.97
17_L	35_L	1.070	0.97
95_P	102_L	1.056	0.96
23_R	43_V	1.055	0.96
15_F	21_A	1.049	0.96
118_A	122_A	1.040	0.96
57_L	62_R	1.039	0.96
98_A	102_L	1.037	0.96
92_A	108_A	1.022	0.96
97_V	104_E	1.020	0.95
128_L	143_A	1.019	0.95
106_L	111_R	0.997	0.95
16_A	38_L	0.996	0.95
131_A	134_L	0.986	0.95
129_A	132_R	0.986	0.95
11_A	15_F	0.978	0.94
66_R	77_A	0.977	0.94
10_L	17_L	0.975	0.94
27_R	33_G	0.970	0.94
21_A	85_H	0.963	0.94
15_F	48_V	0.962	0.94
62_R	65_R	0.961	0.94
17_L	39_F	0.960	0.94
12_A	16_A	0.948	0.93
67_A	74_L	0.947	0.93
91_V	95_P	0.941	0.93
135_L	139_A	0.940	0.93
134_L	138_L	0.935	0.93
39_F	54_A	0.917	0.92
128_L	131_A	0.911	0.92
94_A	99_A	0.907	0.92
62_R	112_R	0.905	0.92
131_A	144_W	0.903	0.92
119_G	123_A	0.898	0.91
41_L	49_V	0.891	0.91
140_T	145_R	0.866	0.90
93_A	98_A	0.851	0.89
92_A	96_P	0.849	0.89
130_A	138_L	0.846	0.89
23_R	36_A	0.846	0.89
74_L	78_S	0.845	0.89
9_L	41_L	0.842	0.88
136_A	141_L	0.840	0.88
91_V	104_E	0.832	0.88
65_R	69_L	0.830	0.88
139_A	143_A	0.827	0.88
89_A	96_P	0.826	0.87
88_A	100_P	0.820	0.87
130_A	133_W	0.819	0.87
42_I	57_L	0.813	0.87
138_L	141_L	0.813	0.87
16_A	34_A	0.806	0.86
138_L	143_A	0.796	0.85
47_I	78_S	0.795	0.85
100_P	107_L	0.791	0.85
104_E	107_L	0.787	0.85
89_A	104_E	0.772	0.84
120_L	123_A	0.768	0.83
36_A	43_V	0.768	0.83
31_V	35_L	0.763	0.83
89_A	93_A	0.761	0.83
17_L	23_R	0.758	0.83
127_R	139_A	0.758	0.83
68_R	71_A	0.757	0.82
142_A	146_R	0.753	0.82
31_V	42_I	0.751	0.82
99_A	105_L	0.746	0.82
68_R	74_L	0.746	0.82
127_R	136_A	0.745	0.81
138_L	146_R	0.737	0.81
118_A	123_A	0.734	0.80
92_A	103_F	0.728	0.80
126_P	129_A	0.728	0.80
76_A	141_L	0.724	0.80
91_V	100_P	0.723	0.79
97_V	100_P	0.723	0.79
22_L	78_S	0.720	0.79
40_P	44_D	0.710	0.78
90_V	93_A	0.707	0.78
21_A	79_V	0.699	0.77
27_R	36_A	0.692	0.76
79_V	82_N	0.691	0.76
99_A	102_L	0.690	0.76
22_L	44_D	0.683	0.76
44_D	55_L	0.682	0.75
43_V	107_L	0.680	0.75
48_V	52_L	0.674	0.75
107_L	110_V	0.673	0.74
20_A	35_L	0.672	0.74
87_W	92_A	0.671	0.74
93_A	97_V	0.671	0.74
76_A	80_A	0.670	0.74
135_L	140_T	0.662	0.73
7_V	12_A	0.658	0.73
14_A	49_V	0.654	0.72
71_A	75_A	0.653	0.72
95_P	105_L	0.651	0.72
139_A	146_R	0.648	0.72
68_R	111_R	0.646	0.71
22_L	31_V	0.639	0.71
69_L	73_A	0.633	0.70
6_G	56_A	0.632	0.70
112_R	116_R	0.630	0.70
17_L	37_W	0.626	0.69
119_G	125_A	0.623	0.69
64_A	67_A	0.620	0.68
130_A	134_L	0.619	0.68
101_V	106_L	0.614	0.68
9_L	20_A	0.608	0.67
136_A	143_A	0.608	0.67
61_G	76_A	0.605	0.66
12_A	122_A	0.604	0.66
16_A	56_A	0.598	0.66
96_P	108_A	0.598	0.66
50_A	74_L	0.597	0.65
128_L	140_T	0.595	0.65
18_S	103_F	0.594	0.65
21_A	25_L	0.587	0.64
51_A	71_A	0.584	0.64
46_G	85_H	0.582	0.63
14_A	46_G	0.581	0.63
43_V	47_I	0.577	0.63
72_W	78_S	0.566	0.61
41_L	46_G	0.564	0.61
22_L	85_H	0.561	0.61
135_L	141_L	0.556	0.60
141_L	145_R	0.552	0.59
139_A	145_R	0.545	0.58
134_L	141_L	0.543	0.58
90_V	96_P	0.541	0.58
3_A	53_L	0.540	0.58
10_L	45_G	0.536	0.57
103_F	107_L	0.534	0.57
103_F	108_A	0.533	0.57
21_A	81_A	0.533	0.57
117_R	120_L	0.527	0.56
99_A	104_E	0.522	0.55
3_A	45_G	0.519	0.55
135_L	144_W	0.515	0.54
137_P	145_R	0.514	0.54
9_L	62_R	0.509	0.53
113_A	117_R	0.509	0.53
136_A	145_R	0.508	0.53
32_P	46_G	0.506	0.53
19_Y	79_V	0.505	0.53
57_L	109_A	0.503	0.53
41_L	89_A	0.502	0.52
20_A	56_A	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4i0uA	4	0.3312	3.2	0.929	Contact Map
4ev6A	3	0.3438	1.8	0.938	Contact Map
3giaA	1	0.6875	1.1	0.945	Contact Map
3ne5A	3	0.375	1	0.946	Contact Map
3ixzA	1	0.4375	0.9	0.947	Contact Map
3wu2J	1	0.1625	0.8	0.95	Contact Map
2zxeA	1	0.4188	0.7	0.951	Contact Map
1m56D	1	0.1125	0.7	0.952	Contact Map
1qleD	1	0.1125	0.7	0.953	Contact Map
1wazA	1	0.2875	0.6	0.953	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.