DUF2735 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2735 - Protein of unknown function (DUF2735)

PFAM:	PF10931	Sequences: SAKIYQFPAGGRAALGGRRGEAKAAADLAAPRVNEAACGGSWYHEAAIQEAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	52 (51)
Sequences:	1846 (1192)
Seq/√Len:	166.9
META:	0.934

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_E	49_Q	5.329	1.00
10_G	13_A	4.047	1.00
46_A	50_E	2.469	1.00
10_G	14_A	1.943	1.00
39_G	45_E	1.917	1.00
36_A	39_G	1.661	1.00
6_Q	9_A	1.657	1.00
32_R	35_E	1.610	1.00
9_A	13_A	1.602	1.00
28_L	31_P	1.566	1.00
25_A	28_L	1.562	1.00
11_G	14_A	1.529	1.00
46_A	49_Q	1.438	1.00
20_G	23_K	1.413	1.00
37_A	45_E	1.318	1.00
19_R	22_A	1.172	1.00
40_G	45_E	1.142	1.00
44_H	47_A	1.131	1.00
10_G	15_L	1.069	1.00
33_V	36_A	1.040	0.99
26_A	29_A	1.016	0.99
27_D	30_A	1.011	0.99
25_A	30_A	1.009	0.99
22_A	29_A	0.971	0.99
34_N	39_G	0.957	0.99
9_A	15_L	0.956	0.99
28_L	33_V	0.921	0.99
3_K	13_A	0.859	0.98
22_A	27_D	0.839	0.97
43_Y	47_A	0.829	0.97
1_S	35_E	0.822	0.97
25_A	29_A	0.787	0.96
29_A	32_R	0.779	0.96
6_Q	31_P	0.778	0.96
14_A	17_G	0.775	0.96
37_A	46_A	0.770	0.95
32_R	37_A	0.768	0.95
27_D	32_R	0.760	0.95
30_A	35_E	0.755	0.95
38_C	41_S	0.753	0.95
41_S	48_I	0.747	0.95
41_S	45_E	0.747	0.95
2_A	7_F	0.743	0.95
23_K	27_D	0.733	0.94
4_I	7_F	0.731	0.94
20_G	24_A	0.704	0.93
18_R	22_A	0.701	0.93
47_A	50_E	0.697	0.92
16_G	19_R	0.681	0.92
1_S	25_A	0.672	0.91
1_S	6_Q	0.667	0.91
16_G	40_G	0.662	0.90
36_A	41_S	0.657	0.90
24_A	28_L	0.655	0.90
1_S	31_P	0.646	0.89
35_E	38_C	0.642	0.89
23_K	33_V	0.628	0.88
1_S	4_I	0.626	0.88
22_A	25_A	0.623	0.88
42_W	51_A	0.617	0.87
28_L	32_R	0.607	0.86
27_D	34_N	0.581	0.84
26_A	32_R	0.579	0.84
22_A	26_A	0.571	0.83
40_G	46_A	0.570	0.83
6_Q	49_Q	0.562	0.82
1_S	28_L	0.558	0.81
3_K	27_D	0.538	0.79
34_N	38_C	0.538	0.79
21_E	27_D	0.531	0.78
19_R	23_K	0.525	0.77
17_G	26_A	0.519	0.76
32_R	45_E	0.508	0.75
8_P	51_A	0.501	0.74
12_R	48_I	0.501	0.74
38_C	45_E	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kyjA	1	0.2308	3.5	0.879	Contact Map
2gmfA	1	0.3846	3.3	0.88	Contact Map
4eyzA	1	0.3846	3.2	0.881	Contact Map
2wsdA	1	0.5192	2.7	0.885	Contact Map
2r7eA	1	0.6923	2.6	0.887	Contact Map
3abgA	1	0.5192	2.6	0.887	Contact Map
1xioA	2	0	2.4	0.888	Contact Map
3oaeA	5	0.3654	2.1	0.893	Contact Map
3gyrA	4	1	2	0.893	Contact Map
2r5iA	5	0.3654	2	0.893	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.