DUF2781 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2781 - Protein of unknown function (DUF2781)

PFAM:	PF10914	Sequences: DLVFLVFFLINLPITLLVDLEQLLPYPLWPAPLVDLVHWYIGTFFDPLLLARPAWFRATIWIDALFQGPFYLVAIYAFLKRNWIRLPALIYAGMMATNVLIILGEELFGPHPKASRATPNLLKVLAANLPYLLIPLLLLLRMWRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	145 (138)
Sequences:	1362 (932)
Seq/√Len:	79.3
META:	0.59

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_Q	25_P	4.230	1.00
40_Y	127_A	2.760	1.00
91_Y	138_L	2.759	1.00
26_Y	29_W	2.754	1.00
93_G	97_T	2.593	1.00
107_L	121_L	2.455	1.00
58_A	104_G	2.373	1.00
94_M	97_T	2.368	1.00
12_L	72_L	2.296	1.00
20_L	24_L	2.155	1.00
76_Y	81_R	2.066	1.00
96_A	132_L	2.016	1.00
70_F	74_A	1.948	1.00
76_Y	83_W	1.879	1.00
78_F	88_A	1.839	1.00
70_F	88_A	1.838	1.00
20_L	64_A	1.781	1.00
31_A	35_D	1.776	1.00
88_A	142_M	1.761	1.00
61_W	65_L	1.751	1.00
3_V	134_I	1.718	1.00
86_L	89_L	1.697	1.00
70_F	87_P	1.664	1.00
59_T	98_N	1.619	1.00
107_L	125_L	1.596	1.00
92_A	139_L	1.585	1.00
133_L	137_L	1.559	0.99
90_I	93_G	1.547	0.99
96_A	139_L	1.532	0.99
6_V	10_I	1.506	0.99
5_L	79_L	1.501	0.99
111_H	117_A	1.501	0.99
62_I	94_M	1.497	0.99
117_A	120_N	1.488	0.99
9_L	75_I	1.487	0.99
4_F	138_L	1.483	0.99
5_L	75_I	1.479	0.99
140_L	143_W	1.463	0.99
138_L	142_M	1.397	0.99
122_L	126_A	1.394	0.99
67_Q	71_Y	1.388	0.99
94_M	100_L	1.347	0.98
11_N	15_T	1.335	0.98
55_W	110_P	1.318	0.98
7_F	11_N	1.307	0.98
4_F	137_L	1.290	0.98
31_A	34_V	1.259	0.98
58_A	101_I	1.238	0.97
138_L	141_R	1.174	0.96
5_L	9_L	1.167	0.96
4_F	141_R	1.164	0.96
40_Y	44_F	1.159	0.96
86_L	143_W	1.145	0.96
12_L	68_G	1.137	0.96
129_L	132_L	1.134	0.96
77_A	84_I	1.134	0.96
46_D	49_L	1.133	0.96
17_L	24_L	1.132	0.96
105_E	110_P	1.130	0.96
98_N	101_I	1.125	0.95
104_G	107_L	1.112	0.95
17_L	33_L	1.098	0.95
78_F	138_L	1.072	0.94
89_L	93_G	1.068	0.94
73_V	83_W	1.050	0.93
62_I	96_A	1.045	0.93
128_N	131_Y	1.030	0.93
16_L	68_G	1.025	0.93
45_F	120_N	1.022	0.92
21_E	24_L	1.012	0.92
2_L	6_V	1.007	0.92
67_Q	91_Y	1.004	0.92
9_L	79_L	0.996	0.91
70_F	77_A	0.956	0.90
58_A	100_L	0.955	0.90
54_A	110_P	0.948	0.89
4_F	8_F	0.929	0.88
86_L	140_L	0.921	0.88
59_T	101_I	0.919	0.88
95_M	98_N	0.910	0.87
66_F	94_M	0.908	0.87
63_D	131_Y	0.904	0.87
103_L	125_L	0.901	0.87
67_Q	98_N	0.895	0.86
33_L	37_V	0.879	0.85
15_T	68_G	0.873	0.85
62_I	100_L	0.867	0.85
23_L	60_I	0.865	0.84
54_A	104_G	0.863	0.84
100_L	104_G	0.859	0.84
124_V	131_Y	0.852	0.84
54_A	57_R	0.850	0.83
76_Y	80_K	0.846	0.83
63_D	124_V	0.843	0.83
35_D	38_H	0.842	0.83
15_T	71_Y	0.831	0.82
11_N	14_I	0.830	0.82
137_L	140_L	0.828	0.82
13_P	17_L	0.819	0.81
104_G	108_F	0.816	0.81
11_N	71_Y	0.814	0.81
120_N	123_K	0.811	0.80
77_A	83_W	0.811	0.80
103_L	132_L	0.809	0.80
34_V	37_V	0.805	0.80
67_Q	94_M	0.804	0.80
10_I	131_Y	0.791	0.79
77_A	87_P	0.784	0.78
48_L	56_F	0.783	0.78
3_V	10_I	0.783	0.78
130_P	137_L	0.783	0.78
45_F	123_K	0.781	0.78
67_Q	128_N	0.780	0.78
63_D	67_Q	0.777	0.77
63_D	128_N	0.775	0.77
76_Y	79_L	0.768	0.77
36_L	39_W	0.767	0.77
84_I	87_P	0.767	0.77
89_L	94_M	0.766	0.76
78_F	142_M	0.753	0.75
88_A	138_L	0.752	0.75
80_K	84_I	0.749	0.75
14_I	18_V	0.748	0.75
21_E	25_P	0.745	0.74
62_I	95_M	0.742	0.74
32_P	35_D	0.739	0.74
55_W	102_I	0.735	0.73
66_F	87_P	0.734	0.73
12_L	16_L	0.733	0.73
2_L	10_I	0.733	0.73
68_G	71_Y	0.732	0.73
18_V	21_E	0.725	0.72
99_V	102_I	0.723	0.72
57_R	104_G	0.722	0.72
98_N	128_N	0.719	0.72
124_V	128_N	0.717	0.72
11_N	16_L	0.717	0.72
31_A	66_F	0.716	0.72
3_V	137_L	0.700	0.70
48_L	53_P	0.692	0.69
127_A	130_P	0.692	0.69
34_V	38_H	0.687	0.68
96_A	100_L	0.684	0.68
83_W	87_P	0.680	0.68
58_A	121_L	0.674	0.67
75_I	79_L	0.650	0.64
95_M	100_L	0.650	0.64
42_G	50_L	0.648	0.64
63_D	71_Y	0.645	0.64
95_M	134_I	0.644	0.63
92_A	96_A	0.641	0.63
31_A	133_L	0.640	0.63
72_L	76_Y	0.639	0.63
58_A	94_M	0.638	0.63
7_F	10_I	0.637	0.63
107_L	122_L	0.634	0.62
122_L	125_L	0.633	0.62
47_P	109_G	0.631	0.62
13_P	130_P	0.631	0.62
64_A	80_K	0.626	0.61
77_A	89_L	0.618	0.60
20_L	25_P	0.618	0.60
46_D	63_D	0.618	0.60
55_W	101_I	0.616	0.60
88_A	92_A	0.614	0.60
118_T	121_L	0.605	0.59
82_N	85_R	0.602	0.58
20_L	23_L	0.598	0.58
108_F	111_H	0.592	0.57
89_L	139_L	0.592	0.57
39_W	45_F	0.586	0.56
8_F	91_Y	0.585	0.56
37_V	40_Y	0.583	0.56
33_L	36_L	0.581	0.56
38_H	42_G	0.579	0.55
105_E	109_G	0.577	0.55
97_T	101_I	0.576	0.55
55_W	121_L	0.569	0.54
40_Y	123_K	0.568	0.54
66_F	91_Y	0.568	0.54
5_L	12_L	0.561	0.53
47_P	106_E	0.556	0.52
71_Y	74_A	0.555	0.52
1_D	10_I	0.555	0.52
75_I	129_L	0.555	0.52
74_A	84_I	0.554	0.52
87_P	92_A	0.548	0.51
28_L	32_P	0.544	0.51
73_V	84_I	0.544	0.51
95_M	99_V	0.542	0.51
66_F	74_A	0.538	0.50
1_D	141_R	0.537	0.50
38_H	41_I	0.536	0.50
54_A	58_A	0.532	0.49
25_P	29_W	0.519	0.48
82_N	89_L	0.519	0.48
70_F	84_I	0.517	0.47
36_L	40_Y	0.516	0.47
86_L	93_G	0.513	0.47
13_P	16_L	0.512	0.47
53_P	131_Y	0.510	0.46
125_L	130_P	0.508	0.46
22_Q	49_L	0.506	0.46
66_F	97_T	0.505	0.46
9_L	16_L	0.504	0.46
33_L	130_P	0.502	0.45
59_T	97_T	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wvfA	1	0.7103	1.2	0.957	Contact Map
2qjyA	2	0.2345	0.9	0.96	Contact Map
3wu2T	1	0.2069	0.9	0.96	Contact Map
3v2yA	1	0.8483	0.8	0.961	Contact Map
2vpzC	2	0.7103	0.7	0.962	Contact Map
4uc1A	3	0.869	0.7	0.962	Contact Map
2rh1A	1	0.8966	0.7	0.962	Contact Map
2kncA	1	0.2552	0.7	0.963	Contact Map
4z35A	1	0.9034	0.6	0.964	Contact Map
2hewF	3	0.2414	0.6	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.