DUF2690 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2690 - Protein of unknown function (DUF2690)

PFAM:	PF10901	Sequences: HSCDGKDPEAMGCGGDAVTTASTATVGGATVELRYSPTCGAAWARITGAAPGDRVEVTARGGDGRTAAGDTDAYTPMVAVPDPATARAC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	89 (86)
Sequences:	974 (803)
Seq/√Len:	86.6
META:	0.476

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_E	45_R	5.685	1.00
19_T	34_R	4.123	1.00
16_D	37_P	3.608	1.00
34_R	45_R	3.390	1.00
6_K	77_M	3.352	1.00
41_A	79_A	2.470	1.00
32_E	47_T	2.132	1.00
35_Y	42_A	2.119	1.00
44_A	75_T	2.064	1.00
7_D	10_A	1.885	1.00
18_V	37_P	1.825	1.00
23_T	31_V	1.825	1.00
42_A	80_V	1.747	1.00
40_G	79_A	1.626	1.00
62_G	65_R	1.601	1.00
7_D	74_Y	1.507	1.00
40_G	80_V	1.446	0.99
35_Y	40_G	1.425	0.99
37_P	40_G	1.411	0.99
65_R	69_G	1.403	0.99
44_A	55_V	1.321	0.99
50_A	53_D	1.225	0.98
66_T	69_G	1.213	0.98
24_A	29_A	1.198	0.98
61_G	65_R	1.197	0.98
36_S	39_C	1.197	0.98
42_A	78_V	1.196	0.98
32_E	44_A	1.173	0.97
16_D	38_T	1.155	0.97
60_R	64_G	1.111	0.96
41_A	77_M	1.092	0.96
3_C	6_K	1.087	0.96
82_D	85_T	1.077	0.95
45_R	74_Y	1.071	0.95
13_C	39_C	1.063	0.95
25_T	28_G	1.053	0.95
24_A	30_T	1.043	0.95
7_D	12_G	0.981	0.93
8_P	31_V	0.973	0.92
14_G	34_R	0.949	0.91
81_P	85_T	0.946	0.91
4_D	8_P	0.932	0.91
31_V	46_I	0.916	0.90
8_P	74_Y	0.909	0.89
8_P	72_D	0.899	0.89
51_P	54_R	0.892	0.89
9_E	34_R	0.872	0.87
6_K	11_M	0.863	0.87
49_A	53_D	0.859	0.87
32_E	74_Y	0.858	0.87
3_C	41_A	0.856	0.86
31_V	59_A	0.847	0.86
19_T	32_E	0.832	0.85
23_T	28_G	0.831	0.85
80_V	83_P	0.826	0.84
23_T	26_V	0.817	0.84
59_A	62_G	0.815	0.84
60_R	63_D	0.812	0.83
57_V	78_V	0.809	0.83
12_G	15_G	0.805	0.83
62_G	67_A	0.798	0.82
60_R	68_A	0.746	0.78
59_A	69_G	0.744	0.78
15_G	18_V	0.736	0.77
40_G	48_G	0.735	0.77
5_G	75_T	0.726	0.76
52_G	55_V	0.719	0.75
17_A	20_T	0.716	0.75
6_K	36_S	0.713	0.75
42_A	88_A	0.713	0.75
17_A	38_T	0.711	0.74
60_R	67_A	0.705	0.74
16_D	36_S	0.698	0.73
11_M	77_M	0.696	0.73
7_D	44_A	0.694	0.73
62_G	69_G	0.693	0.72
28_G	51_P	0.682	0.71
4_D	79_A	0.672	0.70
56_E	63_D	0.669	0.70
47_T	72_D	0.666	0.70
44_A	54_R	0.665	0.69
58_T	66_T	0.658	0.69
58_T	64_G	0.656	0.68
80_V	86_A	0.656	0.68
21_A	28_G	0.656	0.68
8_P	20_T	0.647	0.67
4_D	78_V	0.646	0.67
61_G	67_A	0.645	0.67
43_W	77_M	0.640	0.66
33_L	42_A	0.640	0.66
59_A	78_V	0.638	0.66
40_G	83_P	0.632	0.65
22_S	32_E	0.631	0.65
20_T	75_T	0.630	0.65
51_P	68_A	0.625	0.65
22_S	44_A	0.621	0.64
21_A	38_T	0.619	0.64
12_G	74_Y	0.614	0.63
46_I	49_A	0.603	0.62
19_T	45_R	0.598	0.61
20_T	26_V	0.597	0.61
53_D	57_V	0.595	0.61
64_G	67_A	0.594	0.61
9_E	12_G	0.592	0.60
65_R	68_A	0.589	0.60
42_A	81_P	0.582	0.59
81_P	86_A	0.582	0.59
46_I	74_Y	0.577	0.59
16_D	19_T	0.575	0.58
55_V	58_T	0.575	0.58
14_G	44_A	0.568	0.57
8_P	14_G	0.560	0.56
6_K	21_A	0.554	0.55
49_A	69_G	0.552	0.55
41_A	76_P	0.534	0.53
58_T	87_R	0.531	0.52
63_D	71_T	0.529	0.52
76_P	79_A	0.528	0.52
25_T	29_A	0.525	0.52
53_D	70_D	0.525	0.52
17_A	36_S	0.517	0.50
34_R	74_Y	0.515	0.50
18_V	21_A	0.511	0.50
3_C	37_P	0.511	0.50
59_A	75_T	0.509	0.49
61_G	66_T	0.506	0.49
5_G	78_V	0.501	0.48
8_P	44_A	0.500	0.48
58_T	68_A	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4o30A	1	0.5393	3.1	0.917	Contact Map
2ykaB	1	0.2584	2.8	0.919	Contact Map
1lr7A	1	0.4494	1.1	0.936	Contact Map
1tbrR	1	0.4607	1	0.937	Contact Map
3bmzA	2	0.3483	0.9	0.94	Contact Map
2m5xA	1	0.427	0.9	0.94	Contact Map
1bndA	2	0.6629	0.8	0.94	Contact Map
4icvA	1	0.3933	0.8	0.941	Contact Map
2pmvA	1	0.3371	0.8	0.942	Contact Map
1wwwV	2	0.6067	0.7	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.