AbiGi - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AbiGi - Putative abortive phage resistance protein AbiGi, antitoxin

PFAM:	PF10899	Sequences: NGFYPRYCLEDISYLNIKKNKIPIKEIAIPMVCFCDIPLSQIKEHIKKYGKYGIGLSKEWGIKNGLNPVLYINKNSPLAKSLSELLKKLLKLLSDIFKEDELDKLYNNLLNLLRYIKPYEGKLKRNGKYKNKRFYDEREWRYVPDIDEIELPLLSEEEFTDKKKKNKNNKKLKKYRLKFEPDDIKYIIVP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	190 (179)
Sequences:	740 (701)
Seq/√Len:	52.4
META:	0.819

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
133_R	136_D	3.631	1.00
48_K	132_K	3.461	1.00
120_E	133_R	3.013	1.00
36_D	58_K	2.895	1.00
165_K	169_N	2.617	1.00
179_F	183_D	2.571	1.00
67_N	73_N	2.468	1.00
35_C	45_H	2.353	1.00
117_K	121_G	2.347	1.00
135_Y	138_R	2.334	1.00
59_E	63_K	2.243	1.00
154_L	159_F	2.220	1.00
42_I	46_I	2.210	1.00
169_N	172_L	2.172	1.00
134_F	144_P	2.157	1.00
136_D	188_I	2.081	1.00
38_P	135_Y	2.072	1.00
53_G	188_I	2.044	1.00
118_P	121_G	1.991	1.00
138_R	188_I	1.961	1.00
154_L	158_E	1.924	0.99
168_N	171_K	1.873	0.99
67_N	70_L	1.867	0.99
56_L	179_F	1.849	0.99
121_G	134_F	1.846	0.99
165_K	168_N	1.833	0.99
32_V	67_N	1.810	0.99
120_E	131_N	1.803	0.99
57_S	185_K	1.758	0.99
161_D	165_K	1.748	0.99
123_L	132_K	1.693	0.99
37_I	42_I	1.655	0.98
153_L	159_F	1.580	0.98
33_C	132_K	1.572	0.98
33_C	118_P	1.562	0.98
119_Y	133_R	1.551	0.98
119_Y	179_F	1.537	0.97
64_N	180_E	1.531	0.97
35_C	41_Q	1.491	0.97
113_L	117_K	1.489	0.97
61_G	185_K	1.485	0.97
49_Y	137_E	1.475	0.97
63_K	182_D	1.470	0.97
55_G	67_N	1.461	0.97
58_K	61_G	1.449	0.96
39_L	55_G	1.423	0.96
75_N	80_K	1.411	0.96
33_C	123_L	1.391	0.95
56_L	183_D	1.388	0.95
38_P	42_I	1.383	0.95
7_Y	10_E	1.377	0.95
35_C	52_Y	1.368	0.95
55_G	186_Y	1.358	0.95
41_Q	138_R	1.343	0.94
11_D	14_Y	1.330	0.94
5_P	33_C	1.301	0.93
42_I	53_G	1.290	0.93
30_P	35_C	1.275	0.93
67_N	78_L	1.268	0.92
40_S	55_G	1.227	0.91
56_L	64_N	1.212	0.91
119_Y	136_D	1.209	0.91
35_C	186_Y	1.199	0.90
15_L	18_K	1.191	0.90
12_I	15_L	1.181	0.90
33_C	69_V	1.167	0.89
26_E	156_E	1.147	0.88
6_R	33_C	1.143	0.88
57_S	172_L	1.141	0.88
56_L	60_W	1.141	0.88
48_K	123_L	1.132	0.87
46_I	133_R	1.128	0.87
123_L	134_F	1.109	0.86
52_Y	57_S	1.101	0.86
118_P	132_K	1.100	0.86
54_I	187_I	1.091	0.85
155_S	159_F	1.065	0.84
45_H	53_G	1.059	0.84
7_Y	12_I	1.050	0.83
73_N	132_K	1.044	0.83
58_K	119_Y	1.044	0.83
34_F	140_W	1.042	0.83
166_N	169_N	1.041	0.83
9_L	12_I	1.033	0.82
134_F	137_E	1.028	0.82
5_P	11_D	1.021	0.81
35_C	38_P	1.020	0.81
91_K	96_I	1.015	0.81
33_C	45_H	1.014	0.81
30_P	144_P	0.998	0.80
9_L	14_Y	0.995	0.80
158_E	164_K	0.986	0.79
33_C	36_D	0.984	0.79
36_D	45_H	0.979	0.79
45_H	58_K	0.979	0.79
84_E	108_N	0.968	0.78
60_W	64_N	0.966	0.78
82_L	86_L	0.962	0.77
73_N	135_Y	0.958	0.77
40_S	186_Y	0.958	0.77
39_L	45_H	0.954	0.77
67_N	176_R	0.952	0.77
100_D	131_N	0.950	0.76
124_K	129_Y	0.948	0.76
62_I	143_V	0.946	0.76
6_R	12_I	0.943	0.76
166_N	170_K	0.941	0.76
46_I	136_D	0.938	0.76
41_Q	119_Y	0.924	0.74
91_K	158_E	0.923	0.74
72_I	79_A	0.921	0.74
41_Q	136_D	0.919	0.74
38_P	55_G	0.908	0.73
97_F	143_V	0.904	0.73
38_P	186_Y	0.902	0.73
35_C	136_D	0.901	0.73
56_L	66_L	0.898	0.72
155_S	158_E	0.894	0.72
55_G	135_Y	0.892	0.72
78_L	112_L	0.889	0.72
9_L	28_A	0.883	0.71
161_D	169_N	0.883	0.71
71_Y	139_E	0.880	0.71
60_W	117_K	0.880	0.71
35_C	66_L	0.877	0.70
118_P	123_L	0.877	0.70
13_S	17_I	0.876	0.70
60_W	179_F	0.875	0.70
45_H	186_Y	0.865	0.69
37_I	49_Y	0.857	0.69
6_R	14_Y	0.855	0.69
8_C	14_Y	0.853	0.68
62_I	66_L	0.851	0.68
29_I	41_Q	0.842	0.67
67_N	135_Y	0.840	0.67
165_K	172_L	0.839	0.67
44_E	132_K	0.831	0.66
163_K	185_K	0.824	0.66
34_F	66_L	0.824	0.66
50_G	136_D	0.816	0.65
5_P	10_E	0.814	0.65
14_Y	17_I	0.810	0.64
75_N	160_T	0.810	0.64
42_I	142_Y	0.807	0.64
57_S	102_L	0.804	0.64
28_A	39_L	0.803	0.64
57_S	143_V	0.794	0.63
32_V	181_P	0.788	0.62
145_D	178_K	0.785	0.62
160_T	164_K	0.778	0.61
66_L	73_N	0.773	0.61
117_K	134_F	0.764	0.60
57_S	60_W	0.755	0.59
119_Y	123_L	0.751	0.58
170_K	173_K	0.751	0.58
58_K	171_K	0.744	0.58
37_I	45_H	0.740	0.57
5_P	8_C	0.736	0.57
31_M	36_D	0.735	0.57
133_R	138_R	0.729	0.56
91_K	161_D	0.726	0.56
17_I	20_N	0.725	0.56
176_R	187_I	0.725	0.56
61_G	118_P	0.710	0.54
31_M	143_V	0.710	0.54
45_H	140_W	0.710	0.54
144_P	186_Y	0.704	0.54
39_L	42_I	0.704	0.54
179_F	184_I	0.701	0.53
18_K	69_V	0.695	0.53
66_L	177_L	0.694	0.53
32_V	56_L	0.689	0.52
69_V	123_L	0.688	0.52
30_P	137_E	0.687	0.52
35_C	56_L	0.687	0.52
60_W	121_G	0.686	0.52
14_Y	19_K	0.676	0.51
48_K	118_P	0.674	0.50
78_L	82_L	0.670	0.50
117_K	137_E	0.668	0.50
33_C	41_Q	0.667	0.50
106_Y	120_E	0.664	0.49
48_K	136_D	0.664	0.49
151_L	163_K	0.663	0.49
35_C	137_E	0.663	0.49
71_Y	140_W	0.663	0.49
66_L	132_K	0.658	0.49
60_W	142_Y	0.656	0.49
35_C	61_G	0.654	0.48
44_E	48_K	0.650	0.48
36_D	119_Y	0.646	0.48
36_D	135_Y	0.645	0.47
72_I	82_L	0.634	0.46
12_I	54_I	0.629	0.46
112_L	117_K	0.626	0.45
152_P	178_K	0.617	0.44
172_L	176_R	0.613	0.44
60_W	183_D	0.611	0.44
69_V	103_D	0.607	0.43
28_A	36_D	0.603	0.43
45_H	55_G	0.602	0.43
6_R	15_L	0.602	0.43
52_Y	59_E	0.601	0.43
115_Y	125_R	0.601	0.43
60_W	66_L	0.597	0.42
102_L	173_K	0.596	0.42
58_K	140_W	0.595	0.42
35_C	39_L	0.594	0.42
75_N	109_L	0.592	0.42
6_R	11_D	0.588	0.42
12_I	19_K	0.588	0.42
123_L	130_K	0.587	0.41
71_Y	141_R	0.586	0.41
69_V	138_R	0.581	0.41
40_S	48_K	0.581	0.41
7_Y	16_N	0.579	0.41
92_L	182_D	0.577	0.40
121_G	125_R	0.574	0.40
51_K	54_I	0.572	0.40
63_K	183_D	0.572	0.40
99_E	102_L	0.568	0.39
76_S	136_D	0.567	0.39
114_R	135_Y	0.564	0.39
115_Y	118_P	0.563	0.39
46_I	53_G	0.561	0.39
173_K	176_R	0.560	0.39
80_K	174_K	0.559	0.39
142_Y	158_E	0.559	0.39
29_I	114_R	0.558	0.38
154_L	168_N	0.557	0.38
57_S	183_D	0.555	0.38
31_M	189_V	0.552	0.38
100_D	182_D	0.550	0.38
128_K	178_K	0.549	0.38
8_C	12_I	0.548	0.37
134_F	142_Y	0.546	0.37
6_R	123_L	0.545	0.37
91_K	150_E	0.543	0.37
87_K	109_L	0.541	0.37
119_Y	125_R	0.540	0.37
167_K	170_K	0.534	0.36
26_E	172_L	0.532	0.36
79_A	112_L	0.532	0.36
41_Q	132_K	0.531	0.36
119_Y	176_R	0.531	0.36
43_K	85_L	0.529	0.36
11_D	18_K	0.529	0.36
117_K	144_P	0.525	0.35
98_K	154_L	0.525	0.35
98_K	156_E	0.521	0.35
36_D	55_G	0.519	0.35
48_K	121_G	0.518	0.35
62_I	73_N	0.515	0.34
30_P	52_Y	0.514	0.34
66_L	173_K	0.514	0.34
42_I	48_K	0.514	0.34
31_M	35_C	0.513	0.34
88_K	104_K	0.513	0.34
97_F	101_E	0.509	0.34
131_N	169_N	0.509	0.34
52_Y	69_V	0.506	0.33
108_N	182_D	0.505	0.33
12_I	16_N	0.504	0.33
161_D	168_N	0.503	0.33
41_Q	123_L	0.503	0.33
151_L	156_E	0.502	0.33
55_G	138_R	0.501	0.33
46_I	51_K	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4s0vA	1	0.4632	2.5	0.962	Contact Map
4mj7A	2	0.3421	2	0.963	Contact Map
2k1oA	2	0.1316	1.8	0.964	Contact Map
2xvoA	2	0.2947	1.7	0.965	Contact Map
1zk9A	2	0.2579	1.3	0.967	Contact Map
2y0nE	4	0.0737	1.3	0.968	Contact Map
2koeA	1	0.2105	1.2	0.968	Contact Map
3buxB	1	0.5263	1.1	0.969	Contact Map
3c6vA	3	0.3211	1.1	0.969	Contact Map
1m4uA	2	0.3368	1.1	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.