DUF2784 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2784 - Protein of Unknown function (DUF2784)

PFAM:	PF10861	Sequences: RLLADAVLVLHLAFVLFVVLGGLLVWRWPRLAWLHLPAIAWGALIELLGWICPLTPLENWLRRRAGEAGYSGGFIEHYLLPLLYYDAPAGLTRAAQVALGLLVLALNVLVYW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	112 (110)
Sequences:	11829 (8398)
Seq/√Len:	800.7
META:	0.949

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_W	64_R	4.526	1.00
15_V	83_L	3.472	1.00
51_I	56_P	2.785	1.00
44_L	48_L	2.771	1.00
44_L	50_W	2.706	1.00
73_G	76_E	2.538	1.00
45_I	50_W	2.458	1.00
57_L	60_W	2.414	1.00
18_V	42_G	2.397	1.00
28_W	31_L	2.228	1.00
14_F	38_A	2.223	1.00
17_F	31_L	2.203	1.00
7_V	57_L	2.178	1.00
76_E	80_L	2.172	1.00
97_V	101_L	1.886	1.00
14_F	18_V	1.826	1.00
7_V	61_L	1.736	1.00
47_L	97_V	1.704	1.00
59_N	70_Y	1.644	1.00
39_I	103_V	1.600	1.00
26_W	29_P	1.546	1.00
93_R	96_Q	1.478	1.00
17_F	34_L	1.470	1.00
35_H	39_I	1.450	1.00
33_W	37_P	1.424	1.00
43_A	47_L	1.417	1.00
22_G	25_V	1.414	1.00
59_N	69_G	1.333	1.00
99_L	103_V	1.307	1.00
105_A	109_L	1.297	1.00
58_E	62_R	1.266	1.00
47_L	100_G	1.257	1.00
16_L	20_L	1.250	1.00
22_G	110_V	1.206	1.00
34_L	37_P	1.199	1.00
98_A	102_L	1.198	1.00
25_V	32_A	1.195	1.00
60_W	63_R	1.194	1.00
70_Y	77_H	1.182	1.00
62_R	67_E	1.140	1.00
107_N	111_Y	1.140	1.00
94_A	98_A	1.130	1.00
17_F	38_A	1.130	1.00
92_T	96_Q	1.128	1.00
18_V	38_A	1.119	1.00
29_P	32_A	1.092	1.00
63_R	69_G	1.088	1.00
107_N	110_V	1.087	1.00
95_A	98_A	1.082	1.00
26_W	31_L	1.080	1.00
90_G	94_A	1.073	1.00
72_G	77_H	1.052	1.00
47_L	101_L	1.032	1.00
102_L	106_L	1.028	1.00
42_G	45_I	1.027	1.00
88_P	91_L	1.026	1.00
41_W	45_I	0.991	1.00
94_A	97_V	0.982	1.00
39_I	42_G	0.978	1.00
99_L	102_L	0.977	1.00
40_A	44_L	0.972	1.00
5_D	62_R	0.956	1.00
27_R	31_L	0.946	1.00
34_L	38_A	0.927	1.00
14_F	42_G	0.920	1.00
8_L	80_L	0.920	1.00
59_N	72_G	0.919	1.00
29_P	110_V	0.919	1.00
77_H	81_P	0.899	1.00
3_L	61_L	0.893	1.00
85_Y	92_T	0.853	1.00
108_V	111_Y	0.829	1.00
64_R	67_E	0.827	1.00
80_L	84_Y	0.825	1.00
45_I	48_L	0.824	1.00
59_N	77_H	0.823	1.00
56_P	60_W	0.821	1.00
51_I	59_N	0.816	1.00
6_A	10_L	0.814	1.00
26_W	110_V	0.804	1.00
87_A	92_T	0.797	1.00
49_G	93_R	0.783	1.00
17_F	35_H	0.774	1.00
43_A	46_E	0.769	1.00
41_W	46_E	0.756	1.00
14_F	41_W	0.754	1.00
12_L	78_Y	0.754	1.00
12_L	82_L	0.744	1.00
19_V	102_L	0.734	1.00
58_E	74_F	0.731	1.00
104_L	108_V	0.728	1.00
24_L	28_W	0.725	1.00
48_L	51_I	0.721	1.00
93_R	97_V	0.720	1.00
4_A	8_L	0.713	1.00
37_P	41_W	0.710	1.00
38_A	42_G	0.707	1.00
18_V	103_V	0.699	1.00
98_A	101_L	0.698	1.00
103_V	107_N	0.697	1.00
103_V	106_L	0.688	1.00
42_G	46_E	0.685	1.00
43_A	100_G	0.682	1.00
18_V	39_I	0.674	1.00
12_L	79_L	0.661	1.00
29_P	33_W	0.659	1.00
76_E	89_A	0.653	1.00
91_L	95_A	0.648	1.00
99_L	106_L	0.648	1.00
89_A	93_R	0.644	1.00
106_L	111_Y	0.642	1.00
23_L	110_V	0.639	1.00
91_L	94_A	0.638	1.00
19_V	22_G	0.630	1.00
15_V	75_I	0.627	1.00
96_Q	100_G	0.627	1.00
45_I	53_P	0.624	1.00
79_L	92_T	0.621	1.00
101_L	105_A	0.619	1.00
20_L	23_L	0.617	1.00
23_L	26_W	0.617	1.00
2_L	6_A	0.613	1.00
4_A	61_L	0.611	1.00
28_W	32_A	0.610	1.00
59_N	71_S	0.606	1.00
11_H	52_C	0.604	1.00
41_W	48_L	0.593	1.00
86_D	89_A	0.589	1.00
3_L	7_V	0.587	1.00
63_R	71_S	0.581	1.00
67_E	71_S	0.576	1.00
36_L	40_A	0.573	1.00
80_L	86_D	0.573	1.00
24_L	31_L	0.572	1.00
13_A	16_L	0.571	1.00
72_G	80_L	0.571	1.00
39_I	100_G	0.568	1.00
36_L	39_I	0.566	1.00
32_A	37_P	0.557	1.00
84_Y	88_P	0.557	1.00
31_L	34_L	0.552	1.00
22_G	106_L	0.551	1.00
3_L	6_A	0.547	1.00
41_W	50_W	0.546	1.00
30_R	33_W	0.545	1.00
95_A	99_L	0.544	1.00
72_G	76_E	0.544	1.00
57_L	61_L	0.541	1.00
56_P	59_N	0.539	1.00
25_V	29_P	0.538	1.00
21_G	38_A	0.536	1.00
59_N	63_R	0.532	1.00
74_F	84_Y	0.530	1.00
105_A	108_V	0.528	1.00
106_L	110_V	0.528	1.00
17_F	24_L	0.526	1.00
106_L	109_L	0.525	1.00
46_E	84_Y	0.523	1.00
15_V	19_V	0.516	1.00
74_F	78_Y	0.514	1.00
45_I	51_I	0.512	1.00
2_L	5_D	0.508	1.00
88_P	92_T	0.506	1.00
12_L	15_V	0.501	1.00
12_L	83_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rh5C	1	0.2857	18.1	0.889	Contact Map
4he8H	1	0.5625	11	0.899	Contact Map
4od4A	1	0.8571	4.1	0.917	Contact Map
2kv5A	1	0.2946	4	0.918	Contact Map
2ww9C	1	0.1875	3.3	0.921	Contact Map
4b19A	1	0.2679	2.8	0.924	Contact Map
2mpnA	2	0.5089	2.3	0.927	Contact Map
4q4hA	1	0.3304	2.1	0.929	Contact Map
2wwbC	1	0.2946	2	0.93	Contact Map
2mmuA	1	0.1964	1.8	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.