DUF2577 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2577 - Protein of unknown function (DUF2577)

PFAM:	PF10844	Sequences: IKKAALEAVEASKPVDILFGTVTSVSPLKIQVDQKLTLTEDFLILTENVTDYTVEITVDHGTETGTGGSGLKVGDKVLLLRVQGGQKYIVLDR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (91)
Sequences:	1412 (1160)
Seq/√Len:	121.6
META:	0.767

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_I	90_V	3.256	1.00
24_S	29_K	2.873	1.00
45_L	49_V	2.543	1.00
21_T	76_K	2.321	1.00
39_T	42_F	2.099	1.00
25_V	73_V	2.096	1.00
46_T	49_V	2.051	1.00
28_L	45_L	2.041	1.00
75_D	93_R	2.034	1.00
31_Q	37_T	2.027	1.00
29_K	39_T	2.021	1.00
23_T	31_Q	2.006	1.00
47_E	50_T	1.974	1.00
20_G	79_L	1.940	1.00
23_T	37_T	1.875	1.00
6_L	9_V	1.808	1.00
29_K	37_T	1.787	1.00
65_G	68_G	1.619	1.00
38_L	43_L	1.542	1.00
18_L	79_L	1.516	1.00
46_T	92_D	1.506	1.00
60_H	63_E	1.414	1.00
38_L	42_F	1.389	1.00
60_H	67_G	1.373	1.00
56_I	60_H	1.329	1.00
80_L	91_L	1.292	1.00
5_A	8_A	1.279	1.00
82_V	89_I	1.243	0.99
62_T	65_G	1.237	0.99
55_E	59_D	1.229	0.99
19_F	44_I	1.211	0.99
51_D	54_V	1.208	0.99
17_I	80_L	1.181	0.99
17_I	78_L	1.162	0.99
23_T	29_K	1.122	0.99
26_S	74_G	1.116	0.99
51_D	70_G	1.115	0.99
4_A	8_A	1.109	0.99
22_V	27_P	1.079	0.98
81_R	85_G	1.063	0.98
18_L	88_Y	1.061	0.98
78_L	89_I	1.049	0.98
20_G	30_I	1.043	0.98
58_V	62_T	1.042	0.98
79_L	90_V	1.026	0.98
65_G	69_S	1.015	0.98
66_T	69_S	0.974	0.97
61_G	65_G	0.949	0.97
44_I	78_L	0.933	0.96
6_L	11_A	0.933	0.96
19_F	78_L	0.929	0.96
57_T	61_G	0.929	0.96
6_L	10_E	0.928	0.96
25_V	70_G	0.926	0.96
22_V	71_L	0.925	0.96
82_V	87_K	0.922	0.96
48_N	52_Y	0.908	0.96
43_L	90_V	0.905	0.95
25_V	77_V	0.899	0.95
21_T	31_Q	0.886	0.95
6_L	12_S	0.883	0.95
25_V	40_E	0.874	0.95
82_V	91_L	0.863	0.94
21_T	74_G	0.860	0.94
63_E	67_G	0.851	0.94
46_T	91_L	0.845	0.93
47_E	92_D	0.839	0.93
8_A	11_A	0.836	0.93
60_H	66_T	0.833	0.93
4_A	7_E	0.829	0.93
60_H	64_T	0.828	0.93
48_N	92_D	0.827	0.93
61_G	64_T	0.818	0.92
5_A	9_V	0.811	0.92
62_T	69_S	0.806	0.92
7_E	10_E	0.802	0.92
15_V	83_Q	0.794	0.91
33_D	36_L	0.789	0.91
14_P	83_Q	0.786	0.91
26_S	40_E	0.782	0.91
47_E	75_D	0.756	0.89
61_G	66_T	0.752	0.89
11_A	73_V	0.748	0.89
78_L	92_D	0.746	0.88
46_T	89_I	0.745	0.88
3_K	6_L	0.735	0.88
45_L	48_N	0.726	0.87
58_V	61_G	0.723	0.87
26_S	70_G	0.709	0.86
13_K	81_R	0.703	0.85
34_Q	89_I	0.699	0.85
17_I	89_I	0.697	0.85
5_A	14_P	0.682	0.83
22_V	25_V	0.677	0.83
55_E	60_H	0.674	0.83
49_V	71_L	0.666	0.82
59_D	65_G	0.641	0.80
62_T	68_G	0.638	0.79
44_I	87_K	0.637	0.79
9_V	13_K	0.621	0.77
61_G	67_G	0.620	0.77
64_T	68_G	0.617	0.77
46_T	78_L	0.616	0.77
63_E	69_S	0.611	0.76
22_V	30_I	0.610	0.76
55_E	69_S	0.607	0.76
19_F	76_K	0.599	0.75
22_V	28_L	0.594	0.74
19_F	33_D	0.590	0.74
36_L	88_Y	0.589	0.74
60_H	65_G	0.588	0.73
55_E	61_G	0.585	0.73
47_E	93_R	0.584	0.73
59_D	67_G	0.579	0.72
27_P	43_L	0.577	0.72
3_K	7_E	0.572	0.71
58_V	63_E	0.572	0.71
62_T	66_T	0.565	0.71
9_V	12_S	0.562	0.70
78_L	91_L	0.558	0.70
9_V	24_S	0.549	0.68
72_K	75_D	0.549	0.68
30_I	43_L	0.547	0.68
59_D	63_E	0.545	0.68
61_G	68_G	0.544	0.68
64_T	67_G	0.536	0.67
18_L	61_G	0.527	0.65
21_T	25_V	0.519	0.64
53_T	57_T	0.518	0.64
15_V	81_R	0.517	0.64
54_V	60_H	0.517	0.64
84_G	87_K	0.516	0.64
51_D	55_E	0.511	0.63
19_F	89_I	0.508	0.62
16_D	83_Q	0.500	0.61
16_D	81_R	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qwbA	2	0.9355	22.2	0.87	Contact Map
2c0cA	1	0.957	22.1	0.87	Contact Map
3gg8A	3	0.871	19.1	0.874	Contact Map
4pj1O	3	0.8065	18.8	0.874	Contact Map
3nx6A	1	0.5484	17.2	0.876	Contact Map
1a3wA	3	0.8925	17.2	0.876	Contact Map
2b25A	3	0.2151	16.8	0.877	Contact Map
4rvuA	2	0.9355	16	0.878	Contact Map
3pqiA	3	0.7312	16	0.878	Contact Map
2cdcA	3	0.8817	14.9	0.88	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.