DUF2568 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2568 - Protein of unknown function (DUF2568)

PFAM:	PF10823	Sequences: ALRFLLELAALAALGYWGWTTGDGTALRILLAIGAPLLAAVVWGLFAAPKAPVRLPGPVRLLLELVVFGLAAAALAAAGQPVLAVVFAVVAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	92 (90)
Sequences:	4418 (3589)
Seq/√Len:	378.3
META:	0.893

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_A	67_V	3.405	1.00
14_L	39_A	3.137	1.00
3_R	64_E	2.808	1.00
19_W	32_A	2.377	1.00
60_R	64_E	2.346	1.00
11_L	40_A	2.302	1.00
45_L	53_V	2.298	1.00
72_A	88_A	2.179	1.00
42_V	63_L	2.141	1.00
8_L	12_A	1.903	1.00
13_A	75_L	1.837	1.00
55_L	59_V	1.833	1.00
39_A	67_V	1.787	1.00
47_A	63_L	1.700	1.00
10_A	71_A	1.681	1.00
13_A	78_A	1.609	1.00
82_V	86_V	1.593	1.00
51_A	54_R	1.511	1.00
25_T	29_I	1.451	1.00
76_A	81_P	1.443	1.00
22_G	31_L	1.359	1.00
17_W	35_A	1.319	1.00
19_W	28_R	1.288	1.00
40_A	44_G	1.286	1.00
76_A	84_A	1.280	1.00
47_A	64_E	1.240	1.00
16_Y	78_A	1.228	1.00
57_G	61_L	1.223	1.00
25_T	28_R	1.191	1.00
17_W	74_A	1.185	1.00
87_F	91_A	1.167	1.00
6_L	9_A	1.164	1.00
17_W	77_A	1.141	1.00
73_A	77_A	1.120	1.00
12_A	15_G	1.119	1.00
3_R	6_L	1.119	1.00
46_F	53_V	1.104	1.00
16_Y	80_Q	1.102	1.00
15_G	36_P	1.102	1.00
14_L	70_L	1.073	1.00
81_P	85_V	1.063	1.00
45_L	52_P	1.049	1.00
42_V	46_F	1.037	1.00
48_A	51_A	1.026	1.00
32_A	36_P	1.025	1.00
41_V	45_L	1.017	1.00
61_L	64_E	1.014	1.00
47_A	60_R	0.999	1.00
42_V	47_A	0.968	1.00
12_A	16_Y	0.950	1.00
68_F	91_A	0.947	1.00
22_G	28_R	0.943	1.00
15_G	19_W	0.931	1.00
14_L	35_A	0.929	1.00
18_G	36_P	0.926	1.00
47_A	67_V	0.921	1.00
11_L	36_P	0.920	1.00
75_L	83_L	0.913	1.00
48_A	53_V	0.911	1.00
27_L	30_L	0.904	1.00
10_A	39_A	0.904	1.00
10_A	47_A	0.904	1.00
4_F	7_E	0.895	1.00
57_G	60_R	0.893	1.00
18_G	22_G	0.889	1.00
85_V	89_V	0.873	1.00
72_A	84_A	0.873	1.00
47_A	57_G	0.871	1.00
2_L	90_V	0.861	1.00
22_G	27_L	0.852	1.00
48_A	55_L	0.838	1.00
14_L	71_A	0.835	1.00
5_L	9_A	0.828	1.00
55_L	63_L	0.815	1.00
33_I	36_P	0.799	1.00
80_Q	83_L	0.798	1.00
64_E	68_F	0.795	1.00
27_L	31_L	0.788	1.00
3_R	47_A	0.776	1.00
72_A	87_F	0.775	1.00
37_L	40_A	0.774	1.00
14_L	74_A	0.766	1.00
47_A	50_K	0.764	1.00
47_A	51_A	0.760	1.00
33_I	37_L	0.732	1.00
9_A	12_A	0.728	1.00
21_T	31_L	0.724	1.00
88_A	91_A	0.702	0.99
73_A	76_A	0.700	0.99
23_D	28_R	0.680	0.99
53_V	59_V	0.678	0.99
20_T	80_Q	0.677	0.99
70_L	74_A	0.676	0.99
24_G	28_R	0.675	0.99
59_V	62_L	0.672	0.99
86_V	89_V	0.663	0.99
4_F	8_L	0.636	0.99
69_G	72_A	0.632	0.99
12_A	75_L	0.627	0.99
20_T	23_D	0.627	0.99
31_L	36_P	0.626	0.99
9_A	13_A	0.625	0.99
82_V	85_V	0.622	0.99
17_W	21_T	0.621	0.99
13_A	71_A	0.618	0.99
35_A	70_L	0.612	0.99
66_V	70_L	0.606	0.99
24_G	27_L	0.606	0.99
49_P	54_R	0.601	0.98
42_V	67_V	0.601	0.98
45_L	51_A	0.600	0.98
19_W	29_I	0.593	0.98
10_A	68_F	0.589	0.98
6_L	68_F	0.586	0.98
2_L	6_L	0.567	0.98
46_F	55_L	0.566	0.98
64_E	69_G	0.562	0.98
87_F	90_V	0.562	0.98
28_R	32_A	0.560	0.98
9_A	87_F	0.555	0.97
65_L	69_G	0.552	0.97
71_A	87_F	0.549	0.97
6_L	90_V	0.537	0.97
54_R	59_V	0.537	0.97
2_L	5_L	0.536	0.97
29_I	32_A	0.531	0.97
74_A	77_A	0.523	0.96
48_A	52_P	0.521	0.96
13_A	83_L	0.512	0.96
12_A	83_L	0.509	0.96
19_W	33_I	0.505	0.95
35_A	74_A	0.503	0.95
31_L	35_A	0.502	0.95
18_G	35_A	0.501	0.95
45_L	48_A	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1hznA	1	0.3043	1.2	0.917	Contact Map
2mpnA	2	0.4565	1.1	0.919	Contact Map
1zcdA	1	0.5109	1.1	0.921	Contact Map
2lx0A	1	0.2717	0.9	0.923	Contact Map
4xnjA	1	0.5761	0.9	0.925	Contact Map
4ujrT	1	0.2609	0.9	0.925	Contact Map
2mmuA	1	0.337	0.7	0.928	Contact Map
4ub6R	1	0.3696	0.7	0.929	Contact Map
2wa0A	1	0.2826	0.7	0.929	Contact Map
2ksfA	1	0.663	0.6	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.