DUF2599 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2599 - Protein of unknown function (DUF2599)

PFAM:	PF10783	Sequences: IDHAEWVKRGDGSSLRVYPTAAGRAAAPAAADEAWAEVLALAPDADTPGMRAQFVCHWQFAELAAPGKTSWNLEPWRPVVSDAEMVAAGCNPG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (92)
Sequences:	742 (520)
Seq/√Len:	54.2
META:	0.65

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_A	54_F	4.369	1.00
81_S	84_E	2.794	1.00
18_Y	70_S	2.697	1.00
17_V	73_L	2.692	1.00
84_E	88_A	2.542	1.00
82_D	86_V	2.516	1.00
14_S	74_E	2.494	1.00
52_A	82_D	2.137	1.00
81_S	85_M	2.108	1.00
82_D	85_M	2.022	1.00
20_T	23_G	1.934	1.00
52_A	81_S	1.914	1.00
52_A	85_M	1.891	0.99
7_V	16_R	1.844	0.99
15_L	50_M	1.841	0.99
68_K	72_N	1.818	0.99
19_P	24_R	1.790	0.99
15_L	75_P	1.704	0.99
6_W	15_L	1.645	0.99
51_R	55_V	1.636	0.98
80_V	92_P	1.575	0.98
21_A	25_A	1.570	0.98
12_G	76_W	1.540	0.98
52_A	79_V	1.487	0.97
57_H	65_A	1.443	0.97
31_A	55_V	1.319	0.94
14_S	72_N	1.311	0.94
32_D	51_R	1.284	0.94
24_R	70_S	1.267	0.93
14_S	75_P	1.228	0.92
61_A	65_A	1.200	0.91
41_L	45_A	1.179	0.90
85_M	92_P	1.149	0.89
77_R	80_V	1.113	0.87
22_A	35_W	1.092	0.86
3_H	18_Y	1.078	0.86
80_V	85_M	1.073	0.85
83_A	87_A	1.073	0.85
9_R	12_G	1.068	0.85
77_R	92_P	1.065	0.85
60_F	86_V	1.036	0.83
53_Q	56_C	1.025	0.83
49_G	75_P	1.021	0.82
17_V	76_W	0.995	0.81
11_D	47_T	0.982	0.80
28_P	31_A	0.966	0.79
23_G	27_A	0.951	0.78
28_P	55_V	0.945	0.77
26_A	30_A	0.944	0.77
4_A	38_V	0.927	0.76
9_R	16_R	0.916	0.75
85_M	88_A	0.912	0.75
20_T	37_E	0.889	0.73
32_D	36_A	0.877	0.72
7_V	13_S	0.876	0.72
82_D	88_A	0.866	0.71
39_L	43_P	0.853	0.70
34_A	37_E	0.848	0.69
8_K	11_D	0.831	0.68
80_V	84_E	0.827	0.67
59_Q	63_L	0.819	0.67
61_A	74_E	0.819	0.67
59_Q	82_D	0.812	0.66
4_A	17_V	0.808	0.65
39_L	42_A	0.799	0.65
65_A	68_K	0.797	0.64
17_V	37_E	0.793	0.64
8_K	26_A	0.788	0.64
8_K	81_S	0.774	0.62
11_D	76_W	0.773	0.62
27_A	69_T	0.767	0.61
59_Q	86_V	0.766	0.61
79_V	82_D	0.765	0.61
33_E	36_A	0.744	0.59
49_G	85_M	0.743	0.59
52_A	59_Q	0.736	0.58
12_G	92_P	0.731	0.58
86_V	89_G	0.725	0.57
38_V	42_A	0.722	0.57
50_M	68_K	0.715	0.56
26_A	58_W	0.709	0.55
8_K	13_S	0.698	0.54
16_R	70_S	0.691	0.53
3_H	9_R	0.688	0.53
5_E	8_K	0.682	0.53
49_G	52_A	0.675	0.52
35_W	54_F	0.674	0.52
72_N	75_P	0.666	0.51
23_G	37_E	0.664	0.51
40_A	55_V	0.661	0.50
16_R	72_N	0.657	0.50
1_I	26_A	0.656	0.50
60_F	65_A	0.653	0.49
43_P	50_M	0.652	0.49
47_T	50_M	0.645	0.49
4_A	10_G	0.641	0.48
27_A	30_A	0.632	0.47
13_S	25_A	0.628	0.47
49_G	78_P	0.626	0.47
11_D	17_V	0.625	0.46
41_L	60_F	0.624	0.46
39_L	46_D	0.622	0.46
9_R	13_S	0.621	0.46
35_W	45_A	0.619	0.46
38_V	54_F	0.618	0.46
22_A	79_V	0.616	0.46
23_G	54_F	0.610	0.45
53_Q	90_C	0.607	0.45
65_A	69_T	0.601	0.44
24_R	51_R	0.598	0.44
38_V	70_S	0.597	0.44
39_L	44_D	0.596	0.43
6_W	73_L	0.593	0.43
16_R	67_G	0.593	0.43
34_A	58_W	0.593	0.43
33_E	87_A	0.581	0.42
56_C	90_C	0.575	0.41
61_A	64_A	0.570	0.41
16_R	73_L	0.568	0.40
58_W	66_P	0.568	0.40
46_D	49_G	0.553	0.39
55_V	59_Q	0.544	0.38
35_W	46_D	0.543	0.38
11_D	52_A	0.537	0.37
38_V	49_G	0.533	0.37
31_A	51_R	0.532	0.37
35_W	38_V	0.532	0.37
1_I	13_S	0.530	0.37
11_D	59_Q	0.529	0.37
39_L	50_M	0.527	0.36
64_A	86_V	0.520	0.36
50_M	75_P	0.512	0.35
55_V	76_W	0.508	0.35
14_S	26_A	0.508	0.35
17_V	22_A	0.507	0.34
7_V	10_G	0.504	0.34
57_H	72_N	0.503	0.34
28_P	59_Q	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g32A	1	0.9677	7.3	0.918	Contact Map
3f6vA	2	0.5161	3.7	0.929	Contact Map
3n40P	1	0.3978	3.1	0.931	Contact Map
3d3lA	1	0.6882	2.6	0.934	Contact Map
4nreA	4	0.8817	2	0.938	Contact Map
3rdeA	4	0.9247	2	0.938	Contact Map
2cjqA	1	0.0108	1.8	0.94	Contact Map
1mr1C	1	0.3978	1.8	0.94	Contact Map
1loxA	1	0.8602	1.8	0.94	Contact Map
1hsjA	2	0.4301	1.7	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.