DUF2569 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2569 - Protein of unknown function (DUF2569)

PFAM:	PF10754	Sequences: PKGIGGWLILLAIGLVLSPLRLLLSLFSSLSPLFSPGTWAALTTPGSLWAPLLIFELVLNLALLAFSIYLLVLFFRRRRSFPRLFIIFLLASLVFLLLDALLASLIFAALDAEAIRELIRSLIAAAIWIPYFLRSKRVKNTFV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	143 (142)
Sequences:	3183 (2827)
Seq/√Len:	237.2
META:	0.861

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_L	132_F	4.345	1.00
3_G	140_N	3.811	1.00
12_A	74_F	3.305	1.00
85_F	132_F	3.018	1.00
86_I	133_L	3.005	1.00
16_V	75_F	2.857	1.00
130_P	134_R	2.814	1.00
125_A	129_I	2.707	1.00
81_F	132_F	2.476	1.00
72_V	76_R	2.369	1.00
126_A	130_P	2.247	1.00
85_F	89_L	2.223	1.00
59_L	95_F	1.931	1.00
90_L	129_I	1.881	1.00
5_G	137_R	1.787	1.00
136_K	140_N	1.782	1.00
66_F	70_L	1.763	1.00
20_L	24_L	1.721	1.00
4_I	12_A	1.705	1.00
10_L	14_G	1.688	1.00
137_R	141_T	1.681	1.00
82_P	86_I	1.640	1.00
3_G	141_T	1.628	1.00
4_I	74_F	1.620	1.00
9_I	13_I	1.612	1.00
117_E	120_R	1.602	1.00
125_A	130_P	1.597	1.00
56_E	99_D	1.544	1.00
68_I	72_V	1.515	1.00
52_L	56_E	1.465	1.00
81_F	85_F	1.463	1.00
39_W	43_T	1.453	1.00
86_I	129_I	1.413	1.00
93_L	125_A	1.406	1.00
12_A	75_F	1.370	1.00
82_P	85_F	1.368	1.00
135_S	138_V	1.348	1.00
67_S	88_F	1.293	1.00
14_G	128_W	1.270	1.00
120_R	124_A	1.263	1.00
83_R	87_I	1.258	1.00
11_L	81_F	1.248	1.00
18_S	22_L	1.237	1.00
88_F	92_S	1.217	1.00
113_E	116_R	1.212	1.00
87_I	91_A	1.210	1.00
70_L	81_F	1.195	1.00
15_L	70_L	1.185	1.00
14_G	124_A	1.183	1.00
116_R	120_R	1.179	1.00
19_P	22_L	1.168	1.00
56_E	60_N	1.158	1.00
127_I	130_P	1.144	1.00
66_F	84_L	1.140	1.00
19_P	67_S	1.133	1.00
70_L	88_F	1.131	1.00
15_L	88_F	1.106	1.00
43_T	46_G	1.088	1.00
15_L	71_L	1.082	1.00
74_F	81_F	1.075	1.00
12_A	142_F	1.062	1.00
99_D	103_A	1.058	1.00
15_L	85_F	1.043	1.00
71_L	75_F	1.036	1.00
131_Y	137_R	1.031	1.00
4_I	142_F	1.027	1.00
73_L	77_R	1.024	1.00
11_L	128_W	1.016	1.00
22_L	26_L	1.010	1.00
69_Y	73_L	1.005	1.00
67_S	70_L	1.001	1.00
73_L	84_L	0.994	1.00
43_T	50_A	0.993	1.00
11_L	85_F	0.993	1.00
89_L	92_S	0.980	1.00
21_R	25_S	0.976	1.00
92_S	96_L	0.955	1.00
2_K	140_N	0.947	1.00
85_F	88_F	0.944	1.00
69_Y	84_L	0.940	1.00
71_L	74_F	0.938	1.00
37_G	40_A	0.936	1.00
73_L	80_S	0.935	1.00
129_I	133_L	0.934	1.00
51_P	54_I	0.933	1.00
14_G	18_S	0.933	1.00
67_S	71_L	0.930	1.00
111_D	114_A	0.923	1.00
132_F	138_V	0.914	1.00
24_L	28_S	0.910	1.00
44_T	47_S	0.909	1.00
13_I	16_V	0.908	1.00
70_L	85_F	0.890	0.99
19_P	23_L	0.885	0.99
102_L	105_L	0.883	0.99
120_R	128_W	0.876	0.99
73_L	81_F	0.872	0.99
58_V	62_A	0.866	0.99
69_Y	80_S	0.865	0.99
26_L	64_L	0.856	0.99
10_L	13_I	0.855	0.99
11_L	82_P	0.851	0.99
51_P	55_F	0.851	0.99
100_A	104_S	0.841	0.99
101_L	105_L	0.840	0.99
70_L	132_F	0.840	0.99
74_F	142_F	0.837	0.99
83_R	86_I	0.824	0.99
66_F	88_F	0.822	0.99
80_S	83_R	0.809	0.99
93_L	122_L	0.808	0.99
40_A	44_T	0.798	0.99
23_L	27_F	0.787	0.99
3_G	11_L	0.778	0.99
103_A	107_F	0.776	0.99
45_P	51_P	0.775	0.99
71_L	81_F	0.771	0.99
12_A	81_F	0.763	0.98
90_L	94_V	0.756	0.98
111_D	115_I	0.747	0.98
101_L	104_S	0.745	0.98
77_R	142_F	0.743	0.98
89_L	125_A	0.739	0.98
12_A	71_L	0.732	0.98
124_A	130_P	0.726	0.98
12_A	19_P	0.716	0.98
3_G	136_K	0.711	0.97
19_P	71_L	0.708	0.97
38_T	41_A	0.704	0.97
129_I	132_F	0.699	0.97
37_G	41_A	0.698	0.97
124_A	127_I	0.698	0.97
10_L	128_W	0.696	0.97
19_P	141_T	0.690	0.97
79_R	143_V	0.690	0.97
120_R	130_P	0.687	0.97
111_D	117_E	0.685	0.97
5_G	140_N	0.683	0.97
43_T	47_S	0.674	0.97
8_L	131_Y	0.672	0.96
15_L	67_S	0.669	0.96
65_A	69_Y	0.668	0.96
92_S	122_L	0.668	0.96
114_A	117_E	0.665	0.96
63_L	91_A	0.655	0.96
18_S	67_S	0.650	0.96
121_S	124_A	0.648	0.96
57_L	61_L	0.647	0.96
130_P	133_L	0.647	0.96
60_N	95_F	0.644	0.96
12_A	16_V	0.642	0.95
4_I	9_I	0.640	0.95
129_I	142_F	0.634	0.95
97_L	118_L	0.632	0.95
110_L	114_A	0.627	0.95
5_G	9_I	0.623	0.95
78_R	82_P	0.623	0.95
120_R	123_I	0.622	0.95
26_L	31_S	0.613	0.94
49_W	54_I	0.611	0.94
33_L	78_R	0.609	0.94
36_P	40_A	0.605	0.94
15_L	132_F	0.604	0.94
39_W	50_A	0.601	0.94
101_L	106_I	0.600	0.94
115_I	120_R	0.591	0.93
48_L	51_P	0.591	0.93
59_L	66_F	0.591	0.93
55_F	59_L	0.585	0.93
8_L	138_V	0.584	0.93
89_L	132_F	0.580	0.92
63_L	67_S	0.578	0.92
96_L	100_A	0.578	0.92
119_I	126_A	0.576	0.92
5_G	141_T	0.576	0.92
86_I	138_V	0.576	0.92
42_L	49_W	0.575	0.92
69_Y	72_V	0.575	0.92
66_F	72_V	0.574	0.92
13_I	17_L	0.572	0.92
81_F	142_F	0.570	0.92
33_L	40_A	0.570	0.92
132_F	139_K	0.570	0.92
22_L	60_N	0.568	0.92
64_L	68_I	0.565	0.91
11_L	14_G	0.559	0.91
74_F	78_R	0.555	0.91
26_L	109_A	0.554	0.91
80_S	84_L	0.554	0.91
16_V	19_P	0.551	0.90
29_S	32_P	0.548	0.90
94_V	97_L	0.547	0.90
4_I	75_F	0.545	0.90
64_L	67_S	0.545	0.90
15_L	74_F	0.544	0.90
2_K	101_L	0.543	0.90
93_L	97_L	0.542	0.90
61_L	65_A	0.538	0.89
89_L	93_L	0.536	0.89
59_L	91_A	0.535	0.89
91_A	95_F	0.534	0.89
70_L	84_L	0.531	0.89
16_V	71_L	0.529	0.88
12_A	15_L	0.529	0.88
46_G	49_W	0.522	0.88
70_L	74_F	0.515	0.87
38_T	43_T	0.514	0.87
22_L	63_L	0.512	0.87
5_G	117_E	0.509	0.87
25_S	28_S	0.507	0.86
44_T	51_P	0.505	0.86
59_L	113_E	0.502	0.86
123_I	130_P	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l2tA	2	0.3077	6.1	0.908	Contact Map
2jwaA	2	0.3077	5.8	0.909	Contact Map
1iijA	1	0.2448	4.2	0.915	Contact Map
4qndA	2	0.6643	3.9	0.916	Contact Map
4qncA	2	0.5524	3.4	0.918	Contact Map
4ev6A	3	0.4685	3.2	0.92	Contact Map
2ks1B	1	0.3077	3.1	0.92	Contact Map
4i0uA	4	0.4126	2.7	0.923	Contact Map
4hygA	3	0.8531	2.6	0.923	Contact Map
2k1kA	2	0.2657	2.6	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.