DUF2530 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2530 - Protein of unknown function (DUF2530)

PFAM:	PF10745	Sequences: PEPPPLPPLLLDPVPVVAVGTALWAVALVVLLVVRDALDAWLWTCLAGLGLGLLGLAIFRWQRRAARRGARGAQTGL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	77 (70)
Sequences:	1340 (815)
Seq/√Len:	97.4
META:	0.757

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_A	49_L	4.041	1.00
10_L	13_P	2.680	1.00
20_G	23_L	2.339	1.00
53_L	57_A	2.174	1.00
28_L	46_L	2.174	1.00
23_L	27_A	1.796	1.00
31_L	41_W	1.779	1.00
18_A	22_A	1.763	1.00
60_R	64_R	1.679	1.00
69_G	72_G	1.632	1.00
36_D	39_D	1.494	1.00
62_Q	66_A	1.487	1.00
63_R	66_A	1.439	1.00
25_A	46_L	1.404	0.99
43_W	46_L	1.375	0.99
57_A	61_W	1.358	0.99
31_L	42_L	1.329	0.99
28_L	49_L	1.328	0.99
35_R	45_C	1.319	0.99
34_V	37_A	1.313	0.99
27_A	45_C	1.304	0.99
28_L	42_L	1.268	0.99
28_L	45_C	1.255	0.99
35_R	38_L	1.252	0.99
58_I	62_Q	1.208	0.98
21_T	49_L	1.208	0.98
46_L	49_L	1.165	0.98
54_L	58_I	1.157	0.98
65_A	68_R	1.151	0.98
8_P	11_L	1.115	0.97
65_A	72_G	1.114	0.97
5_P	11_L	1.106	0.97
59_F	62_Q	1.092	0.97
29_V	33_V	1.080	0.97
38_L	41_W	1.075	0.97
15_P	18_A	1.034	0.96
23_L	26_V	1.027	0.96
12_D	15_P	1.019	0.96
33_V	36_D	1.002	0.95
64_R	67_R	0.996	0.95
51_L	58_I	0.986	0.95
14_V	18_A	0.978	0.94
6_L	11_L	0.938	0.93
61_W	65_A	0.938	0.93
18_A	56_L	0.936	0.93
35_R	39_D	0.931	0.93
31_L	45_C	0.927	0.93
39_D	42_L	0.921	0.92
16_V	50_G	0.914	0.92
50_G	54_L	0.901	0.92
37_A	40_A	0.894	0.91
26_V	40_A	0.888	0.91
6_L	9_L	0.878	0.91
32_L	42_L	0.862	0.90
26_V	30_V	0.860	0.90
27_A	31_L	0.839	0.89
24_W	45_C	0.834	0.88
17_V	20_G	0.833	0.88
6_L	10_L	0.819	0.87
34_V	38_L	0.819	0.87
30_V	34_V	0.806	0.86
59_F	66_A	0.803	0.86
11_L	15_P	0.785	0.85
20_G	64_R	0.783	0.85
12_D	16_V	0.778	0.84
64_R	68_R	0.762	0.83
43_W	47_A	0.756	0.83
21_T	56_L	0.742	0.82
23_L	55_G	0.718	0.79
32_L	38_L	0.716	0.79
21_T	47_A	0.700	0.78
4_P	7_P	0.700	0.78
10_L	15_P	0.699	0.78
64_R	70_A	0.697	0.77
14_V	22_A	0.695	0.77
9_L	12_D	0.693	0.77
56_L	60_R	0.684	0.76
34_V	40_A	0.671	0.75
33_V	37_A	0.666	0.74
32_L	41_W	0.639	0.71
17_V	59_F	0.629	0.70
17_V	51_L	0.628	0.70
14_V	56_L	0.626	0.69
9_L	22_A	0.619	0.69
38_L	42_L	0.603	0.67
20_G	30_V	0.603	0.67
19_V	22_A	0.602	0.66
6_L	13_P	0.599	0.66
15_P	19_V	0.587	0.65
51_L	57_A	0.580	0.64
9_L	60_R	0.573	0.63
28_L	43_W	0.570	0.62
61_W	64_R	0.566	0.62
16_V	51_L	0.562	0.61
51_L	55_G	0.545	0.59
61_W	70_A	0.538	0.58
23_L	72_G	0.530	0.57
62_Q	65_A	0.525	0.56
16_V	44_T	0.523	0.56
48_G	55_G	0.520	0.55
21_T	63_R	0.517	0.55
51_L	54_L	0.514	0.55
21_T	54_L	0.514	0.55
34_V	64_R	0.509	0.54
28_L	31_L	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4fbzA	3	0.5844	10.4	0.887	Contact Map
2kluA	1	0.5714	9.1	0.89	Contact Map
2x2zA	1	0.1688	7.8	0.894	Contact Map
2l2tA	2	0.5325	7.7	0.894	Contact Map
3o7qA	1	0.987	7	0.895	Contact Map
2gfpA	2	0.987	6.3	0.898	Contact Map
1ohfA	8	0.7922	6.2	0.898	Contact Map
4j05A	3	0.987	6.2	0.898	Contact Map
1pw4A	1	0.987	5.4	0.901	Contact Map
3l1lA	2	0.8312	5.3	0.902	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.