DUF2550 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2550 - Protein of unknown function (DUF2550)

PFAM:	PF10739	Sequences: LLLVLLLLVALAVRRRLLLRGGGTFECSLRRRPARGGRGWRLGVARYSGDELEWYRLFSLSPRPRRVLSRRGLEVVGRRPPEGAEALALPPGAVVVECRTGGGPVELAMSESALTGFLSWLEAAPPG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	127 (127)
Sequences:	1985 (1261)
Seq/√Len:	111.9
META:	0.716

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_R	106_E	4.270	1.00
114_L	118_L	3.491	1.00
77_G	97_E	3.200	1.00
14_R	18_L	3.185	1.00
97_E	104_P	2.853	1.00
79_R	85_E	2.785	1.00
109_M	117_F	2.756	1.00
43_G	54_W	2.750	1.00
16_R	20_R	2.360	1.00
59_S	62_P	2.250	1.00
14_R	20_R	2.244	1.00
47_Y	116_G	2.048	1.00
100_T	103_G	2.042	1.00
99_R	104_P	2.011	1.00
96_V	114_L	1.979	1.00
46_R	53_E	1.941	1.00
41_R	56_R	1.914	1.00
81_P	95_V	1.885	1.00
33_P	36_G	1.845	1.00
69_S	72_G	1.821	1.00
72_G	101_G	1.805	1.00
48_S	51_E	1.749	1.00
53_E	67_V	1.689	1.00
46_R	55_Y	1.654	1.00
90_P	93_A	1.614	1.00
76_V	99_R	1.613	1.00
51_E	67_V	1.606	1.00
74_E	99_R	1.552	1.00
13_V	17_L	1.546	1.00
72_G	83_G	1.513	1.00
121_L	127_G	1.510	1.00
16_R	19_L	1.438	1.00
8_L	12_A	1.344	1.00
118_L	124_A	1.300	0.99
25_F	47_Y	1.254	0.99
98_C	105_V	1.252	0.99
73_L	98_C	1.250	0.99
12_A	20_R	1.246	0.99
113_A	116_G	1.230	0.99
110_S	113_A	1.223	0.99
45_A	116_G	1.213	0.99
115_T	126_P	1.181	0.99
75_V	118_L	1.163	0.99
5_L	8_L	1.157	0.99
42_L	57_L	1.151	0.99
29_L	41_R	1.150	0.99
116_G	121_L	1.149	0.99
38_R	112_S	1.133	0.99
76_V	97_E	1.129	0.98
3_L	7_L	1.099	0.98
48_S	53_E	1.097	0.98
60_L	75_V	1.079	0.98
28_S	42_L	1.052	0.98
58_F	85_E	1.040	0.97
13_V	18_L	1.039	0.97
45_A	52_L	1.027	0.97
1_L	61_S	1.021	0.97
15_R	85_E	1.017	0.97
17_L	22_G	0.985	0.96
19_L	44_V	0.980	0.96
25_F	53_E	0.975	0.96
79_R	106_E	0.968	0.96
12_A	107_L	0.968	0.96
61_S	65_R	0.968	0.96
12_A	31_R	0.961	0.96
27_C	45_A	0.945	0.95
68_L	98_C	0.943	0.95
68_L	118_L	0.939	0.95
12_A	16_R	0.935	0.95
60_L	82_E	0.928	0.95
122_E	125_P	0.926	0.95
28_S	54_W	0.926	0.95
25_F	90_P	0.912	0.95
98_C	107_L	0.905	0.94
31_R	51_E	0.899	0.94
59_S	115_T	0.898	0.94
79_R	95_V	0.879	0.93
94_V	98_C	0.876	0.93
4_V	9_V	0.871	0.93
46_R	49_G	0.863	0.93
96_V	107_L	0.858	0.93
7_L	60_L	0.852	0.92
35_R	38_R	0.852	0.92
40_W	108_A	0.843	0.92
23_G	116_G	0.841	0.92
11_L	109_M	0.821	0.91
24_T	27_C	0.817	0.91
74_E	78_R	0.811	0.90
51_E	73_L	0.805	0.90
87_L	91_P	0.800	0.90
49_G	93_A	0.797	0.89
31_R	61_S	0.796	0.89
17_L	21_G	0.795	0.89
73_L	96_V	0.790	0.89
11_L	14_R	0.783	0.89
7_L	10_A	0.775	0.88
95_V	108_A	0.773	0.88
7_L	12_A	0.768	0.88
20_R	47_Y	0.768	0.88
80_P	94_V	0.753	0.87
1_L	4_V	0.752	0.87
9_V	13_V	0.750	0.86
40_W	85_E	0.739	0.86
101_G	104_P	0.734	0.85
31_R	65_R	0.730	0.85
25_F	45_A	0.728	0.85
74_E	104_P	0.727	0.85
72_G	84_A	0.725	0.85
27_C	109_M	0.724	0.84
77_G	84_A	0.713	0.84
29_L	54_W	0.712	0.83
15_R	58_F	0.706	0.83
37_G	41_R	0.704	0.83
100_T	111_E	0.703	0.83
97_E	106_E	0.696	0.82
61_S	82_E	0.695	0.82
31_R	48_S	0.692	0.82
45_A	54_W	0.690	0.82
123_A	126_P	0.687	0.81
6_L	9_V	0.684	0.81
27_C	90_P	0.680	0.81
29_L	68_L	0.678	0.80
42_L	89_L	0.675	0.80
6_L	71_R	0.666	0.79
30_R	40_W	0.663	0.79
28_S	90_P	0.660	0.79
44_V	54_W	0.653	0.78
15_R	79_R	0.653	0.78
81_P	85_E	0.650	0.78
56_R	65_R	0.645	0.77
105_V	117_F	0.639	0.76
78_R	111_E	0.638	0.76
6_L	10_A	0.637	0.76
25_F	41_R	0.635	0.76
19_L	26_E	0.631	0.75
57_L	71_R	0.628	0.75
29_L	105_V	0.622	0.74
82_E	86_A	0.621	0.74
14_R	54_W	0.616	0.74
77_G	103_G	0.614	0.73
4_V	8_L	0.601	0.72
5_L	67_V	0.598	0.71
12_A	57_L	0.597	0.71
23_G	109_M	0.595	0.71
32_R	41_R	0.591	0.71
4_V	67_V	0.588	0.70
50_D	112_S	0.585	0.70
29_L	36_G	0.581	0.69
1_L	62_P	0.581	0.69
109_M	115_T	0.580	0.69
120_W	123_A	0.576	0.69
32_R	35_R	0.571	0.68
36_G	84_A	0.571	0.68
35_R	72_G	0.563	0.67
114_L	119_S	0.561	0.67
40_W	79_R	0.559	0.66
65_R	124_A	0.554	0.66
120_W	125_P	0.553	0.66
53_E	63_R	0.553	0.66
93_A	110_S	0.552	0.65
22_G	114_L	0.550	0.65
24_T	55_Y	0.547	0.65
80_P	99_R	0.547	0.65
12_A	29_L	0.547	0.65
55_Y	95_V	0.545	0.64
42_L	45_A	0.541	0.64
108_A	123_A	0.540	0.64
33_P	69_S	0.539	0.64
26_E	50_D	0.535	0.63
27_C	54_W	0.535	0.63
72_G	103_G	0.533	0.63
19_L	23_G	0.533	0.63
6_L	17_L	0.530	0.62
22_G	118_L	0.529	0.62
37_G	69_S	0.527	0.62
34_A	47_Y	0.526	0.62
22_G	52_L	0.525	0.62
26_E	89_L	0.525	0.62
1_L	71_R	0.524	0.61
14_R	22_G	0.524	0.61
40_W	43_G	0.523	0.61
79_R	108_A	0.517	0.60
98_C	121_L	0.517	0.60
119_S	122_E	0.517	0.60
66_R	69_S	0.516	0.60
70_R	120_W	0.515	0.60
34_A	123_A	0.513	0.60
15_R	24_T	0.506	0.59
56_R	109_M	0.505	0.59
15_R	106_E	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l2tA	2	0.1811	14.3	0.92	Contact Map
2ks1B	1	0.1732	12.5	0.922	Contact Map
2jwaA	2	0.1654	8.7	0.928	Contact Map
1iijA	1	0.126	8	0.928	Contact Map
1ulrA	1	0.4646	7.2	0.93	Contact Map
2fhmA	1	0.4724	7.1	0.93	Contact Map
4hi1A	3	0.5118	6.5	0.932	Contact Map
2kdoA	1	0.3701	6.1	0.932	Contact Map
1w2iA	2	0.4803	5.7	0.933	Contact Map
2m20A	2	0.315	4.6	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.