DUF2514 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2514 - Protein of unknown function (DUF2514)

PFAM:	PF10721	Sequences: WKPLAIVLLLAAALLWGYAAGRSVEDAEWQAKWAERDAADAEAAAAAEAAARAEEQRRQAAQDEARKDAQQQIAAARADAAAARAAADRLRQQAAALAAAASAAASDPAAAARGQAAADAADVLADLLGRADERAGELAAAADRARIAGLACERAYDALRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (155)
Sequences:	924 (684)
Seq/√Len:	54.9
META:	0.563

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_E	57_R	4.829	1.00
132_D	136_G	4.133	1.00
52_R	55_E	3.931	1.00
132_D	135_A	3.817	1.00
131_A	135_A	3.753	1.00
141_A	145_A	3.281	1.00
54_E	58_R	2.638	1.00
134_R	138_L	2.501	1.00
131_A	134_R	2.395	1.00
151_A	155_A	2.368	1.00
47_A	51_A	2.319	1.00
140_A	144_R	2.302	1.00
141_A	146_R	2.261	1.00
133_E	137_E	1.942	1.00
94_A	97_L	1.937	1.00
64_E	68_D	1.927	1.00
153_E	157_D	1.877	0.99
65_A	151_A	1.809	0.99
19_A	22_R	1.766	0.99
30_Q	33_W	1.745	0.99
25_E	29_W	1.724	0.99
76_A	80_A	1.652	0.99
122_D	137_E	1.625	0.98
22_R	25_E	1.612	0.98
29_W	33_W	1.599	0.98
131_A	136_G	1.584	0.98
65_A	155_A	1.578	0.98
36_R	40_D	1.567	0.98
20_A	24_V	1.545	0.98
130_R	141_A	1.519	0.98
129_G	133_E	1.495	0.97
63_D	67_K	1.485	0.97
31_A	34_A	1.472	0.97
58_R	61_A	1.431	0.97
144_R	148_A	1.427	0.97
70_Q	73_I	1.417	0.96
146_R	150_L	1.382	0.96
131_A	138_L	1.339	0.95
155_A	158_A	1.331	0.95
57_R	61_A	1.295	0.94
149_G	153_E	1.286	0.94
33_W	36_R	1.270	0.93
73_I	77_R	1.238	0.93
77_R	84_R	1.230	0.92
62_Q	155_A	1.228	0.92
45_A	48_E	1.226	0.92
22_R	26_D	1.218	0.92
33_W	37_D	1.210	0.92
70_Q	74_A	1.193	0.91
48_E	52_R	1.193	0.91
29_W	32_K	1.178	0.91
37_D	40_D	1.171	0.90
130_R	135_A	1.170	0.90
59_Q	62_Q	1.169	0.90
18_Y	24_V	1.149	0.89
145_A	149_G	1.148	0.89
44_A	48_E	1.141	0.89
119_D	122_D	1.136	0.89
25_E	28_E	1.122	0.88
54_E	61_A	1.110	0.88
150_L	153_E	1.109	0.88
111_A	155_A	1.108	0.88
93_Q	96_A	1.089	0.87
130_R	134_R	1.082	0.86
41_A	45_A	1.077	0.86
48_E	55_E	1.061	0.85
59_Q	63_D	1.061	0.85
22_R	30_Q	1.053	0.85
13_A	16_W	1.052	0.85
45_A	49_A	1.052	0.85
88_D	91_R	1.045	0.84
14_L	18_Y	1.026	0.83
69_A	151_A	1.020	0.83
83_A	87_A	1.004	0.82
138_L	141_A	0.997	0.81
41_A	47_A	0.986	0.81
40_D	44_A	0.985	0.81
13_A	17_G	0.985	0.81
46_A	50_A	0.979	0.80
49_A	53_A	0.973	0.80
123_V	137_E	0.973	0.80
30_Q	34_A	0.972	0.80
18_Y	23_S	0.961	0.79
31_A	35_E	0.960	0.79
69_A	73_I	0.955	0.79
21_G	29_W	0.955	0.79
25_E	30_Q	0.948	0.78
135_A	138_L	0.947	0.78
94_A	98_A	0.946	0.78
38_A	41_A	0.944	0.78
87_A	132_D	0.941	0.77
68_D	72_Q	0.939	0.77
67_K	70_Q	0.932	0.77
42_E	45_A	0.921	0.76
42_E	46_A	0.918	0.76
93_Q	97_L	0.909	0.75
24_V	27_A	0.902	0.74
142_A	145_A	0.901	0.74
68_D	71_Q	0.898	0.74
154_R	157_D	0.895	0.74
35_E	39_A	0.893	0.74
16_W	19_A	0.880	0.73
141_A	144_R	0.879	0.73
8_L	12_A	0.875	0.72
130_R	133_E	0.871	0.72
88_D	92_Q	0.869	0.72
75_A	79_D	0.867	0.71
7_V	10_L	0.863	0.71
26_D	30_Q	0.861	0.71
6_I	11_A	0.848	0.70
61_A	64_E	0.848	0.70
150_L	154_R	0.837	0.69
52_R	56_Q	0.829	0.68
48_E	51_A	0.823	0.67
29_W	36_R	0.821	0.67
24_V	28_E	0.811	0.66
6_I	9_L	0.809	0.66
83_A	86_A	0.792	0.64
90_L	94_A	0.786	0.64
37_D	45_A	0.785	0.64
117_A	145_A	0.781	0.63
34_A	38_A	0.774	0.63
56_Q	59_Q	0.761	0.61
102_S	105_A	0.757	0.61
117_A	144_R	0.757	0.61
122_D	134_R	0.757	0.61
71_Q	74_A	0.751	0.60
85_A	89_R	0.749	0.60
18_Y	21_G	0.743	0.60
42_E	47_A	0.724	0.58
29_W	34_A	0.724	0.58
22_R	27_A	0.722	0.57
128_L	131_A	0.715	0.57
28_E	32_K	0.712	0.56
26_D	29_W	0.701	0.55
87_A	91_R	0.699	0.55
25_E	34_A	0.695	0.54
29_W	37_D	0.693	0.54
141_A	148_A	0.693	0.54
120_A	137_E	0.688	0.54
20_A	28_E	0.688	0.54
36_R	43_A	0.687	0.54
55_E	59_Q	0.678	0.53
19_A	23_S	0.677	0.53
99_A	110_A	0.672	0.52
122_D	138_L	0.667	0.51
28_E	38_A	0.663	0.51
102_S	110_A	0.660	0.51
97_L	124_L	0.655	0.50
9_L	16_W	0.645	0.49
49_A	56_Q	0.644	0.49
124_L	137_E	0.643	0.49
124_L	132_D	0.643	0.49
27_A	34_A	0.641	0.49
133_E	140_A	0.640	0.49
35_E	38_A	0.639	0.48
12_A	19_A	0.635	0.48
58_R	76_A	0.635	0.48
67_K	71_Q	0.634	0.48
53_A	56_Q	0.633	0.48
93_Q	127_L	0.632	0.48
60_A	64_E	0.631	0.48
26_D	33_W	0.631	0.48
81_A	84_R	0.628	0.47
73_I	76_A	0.626	0.47
16_W	27_A	0.623	0.47
76_A	144_R	0.621	0.47
46_A	49_A	0.619	0.46
76_A	79_D	0.619	0.46
21_G	37_D	0.618	0.46
11_A	15_L	0.609	0.45
63_D	66_R	0.606	0.45
92_Q	106_S	0.603	0.45
84_R	140_A	0.602	0.44
19_A	24_V	0.601	0.44
123_V	141_A	0.599	0.44
25_E	33_W	0.599	0.44
56_Q	160_R	0.597	0.44
113_R	127_L	0.595	0.44
7_V	23_S	0.594	0.44
15_L	18_Y	0.593	0.44
19_A	25_E	0.590	0.43
19_A	30_Q	0.587	0.43
65_A	82_A	0.585	0.43
120_A	123_V	0.581	0.42
86_A	136_G	0.581	0.42
18_Y	25_E	0.581	0.42
12_A	22_R	0.577	0.42
70_Q	77_R	0.576	0.42
72_Q	75_A	0.575	0.42
134_R	137_E	0.573	0.41
30_Q	35_E	0.572	0.41
25_E	36_R	0.570	0.41
65_A	68_D	0.568	0.41
157_D	160_R	0.566	0.41
11_A	99_A	0.561	0.40
36_R	45_A	0.559	0.40
77_R	144_R	0.559	0.40
57_R	62_Q	0.554	0.39
62_Q	125_A	0.554	0.39
7_V	11_A	0.553	0.39
99_A	103_A	0.552	0.39
87_A	90_L	0.548	0.39
89_R	110_A	0.548	0.39
16_W	22_R	0.547	0.39
19_A	26_D	0.547	0.39
24_V	34_A	0.545	0.39
84_R	88_D	0.544	0.38
116_A	149_G	0.543	0.38
51_A	54_E	0.542	0.38
111_A	117_A	0.539	0.38
23_S	32_K	0.539	0.38
10_L	13_A	0.538	0.38
20_A	27_A	0.536	0.38
130_R	142_A	0.534	0.37
115_Q	118_A	0.532	0.37
6_I	10_L	0.527	0.37
48_E	71_Q	0.527	0.37
136_G	140_A	0.526	0.37
24_V	30_Q	0.525	0.37
36_R	39_A	0.518	0.36
15_L	22_R	0.516	0.36
60_A	96_A	0.515	0.36
20_A	23_S	0.513	0.35
72_Q	89_R	0.512	0.35
16_W	20_A	0.512	0.35
102_S	108_P	0.512	0.35
83_A	136_G	0.512	0.35
94_A	128_L	0.502	0.34
33_W	40_D	0.501	0.34
62_Q	65_A	0.500	0.34
147_I	151_A	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q4gX	1	0	11.1	0.922	Contact Map
3rvyA	3	0.1677	4.8	0.934	Contact Map
4pj0R	1	0.1988	3.4	0.939	Contact Map
3rkoA	1	0.1863	3	0.94	Contact Map
2j69A	1	0.8137	2.8	0.941	Contact Map
1m56D	1	0.1118	2.7	0.941	Contact Map
2f93B	2	0.1056	2.7	0.941	Contact Map
5a2fA	1	0	2.6	0.942	Contact Map
4cgkA	3	0.7329	2.5	0.943	Contact Map
4u0qB	1	0	2.5	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.