DUF2499 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2499 - Protein of unknown function (DUF2499)

PFAM:	PF10693	Sequences: ALSLPTWIIHISSVIEWIAAIWLIWRYGEVTGNPAWRGLALAMLPALVSAMCACTWHFFDNAPSLEWLVTLQAALTLLGNCTLALAAWW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	89 (88)
Sequences:	583 (306)
Seq/√Len:	32.6
META:	0.726

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_V	75_L	3.575	1.00
50_A	56_W	3.082	1.00
53_A	69_V	2.282	0.99
42_A	82_T	2.212	0.99
75_L	78_L	2.019	0.98
49_S	73_A	2.016	0.98
47_L	50_A	2.011	0.98
47_L	56_W	1.989	0.98
34_P	37_R	1.949	0.97
25_W	29_E	1.764	0.95
56_W	60_D	1.606	0.92
24_I	39_L	1.590	0.92
13_S	16_E	1.580	0.92
23_L	27_Y	1.563	0.91
81_C	85_L	1.507	0.89
23_L	26_R	1.506	0.89
8_I	12_S	1.439	0.87
72_Q	76_T	1.436	0.87
38_G	41_L	1.417	0.86
9_I	52_C	1.406	0.86
17_W	24_I	1.393	0.85
3_S	7_W	1.391	0.85
3_S	6_T	1.346	0.83
70_T	74_A	1.333	0.83
61_N	80_N	1.328	0.82
44_L	48_V	1.322	0.82
9_I	84_A	1.311	0.82
21_I	60_D	1.293	0.81
2_L	7_W	1.281	0.80
28_G	37_R	1.264	0.79
4_L	8_I	1.246	0.78
49_S	75_L	1.224	0.77
63_P	66_E	1.222	0.77
25_W	37_R	1.213	0.76
29_E	41_L	1.206	0.76
47_L	51_M	1.204	0.76
69_V	72_Q	1.191	0.75
28_G	34_P	1.175	0.74
7_W	10_H	1.174	0.74
45_P	79_G	1.144	0.72
67_W	70_T	1.127	0.71
46_A	54_C	1.127	0.71
38_G	42_A	1.113	0.70
61_N	72_Q	1.096	0.69
58_F	84_A	1.063	0.66
31_T	34_P	1.062	0.66
46_A	56_W	1.054	0.65
32_G	64_S	1.044	0.65
4_L	88_W	1.037	0.64
52_C	70_T	1.014	0.62
2_L	6_T	0.981	0.60
64_S	74_A	0.962	0.58
58_F	67_W	0.958	0.58
14_V	70_T	0.946	0.57
25_W	58_F	0.942	0.57
81_C	84_A	0.934	0.56
49_S	53_A	0.929	0.56
28_G	63_P	0.928	0.55
58_F	66_E	0.920	0.55
19_A	77_L	0.890	0.52
11_I	88_W	0.884	0.52
51_M	56_W	0.877	0.51
44_L	83_L	0.869	0.51
28_G	33_N	0.855	0.49
36_W	54_C	0.853	0.49
50_A	60_D	0.852	0.49
16_E	20_A	0.840	0.48
66_E	81_C	0.833	0.48
17_W	83_L	0.823	0.47
6_T	50_A	0.808	0.46
49_S	54_C	0.808	0.46
34_P	64_S	0.807	0.46
14_V	48_V	0.805	0.45
19_A	25_W	0.801	0.45
53_A	72_Q	0.798	0.45
26_R	44_L	0.797	0.45
28_G	31_T	0.797	0.45
30_V	33_N	0.796	0.45
23_L	43_M	0.795	0.45
25_W	30_V	0.790	0.44
66_E	78_L	0.779	0.43
18_I	51_M	0.756	0.41
74_A	77_L	0.751	0.41
61_N	73_A	0.744	0.40
26_R	85_L	0.740	0.40
84_A	88_W	0.737	0.40
22_W	26_R	0.734	0.40
54_C	58_F	0.725	0.39
26_R	30_V	0.724	0.39
5_P	27_Y	0.723	0.39
19_A	23_L	0.706	0.37
5_P	52_C	0.691	0.36
8_I	58_F	0.690	0.36
26_R	32_G	0.680	0.35
53_A	76_T	0.672	0.35
15_I	19_A	0.650	0.33
5_P	63_P	0.650	0.33
25_W	34_P	0.649	0.33
44_L	88_W	0.649	0.33
61_N	69_V	0.645	0.33
14_V	68_L	0.642	0.33
46_A	83_L	0.640	0.32
43_M	83_L	0.634	0.32
12_S	71_L	0.629	0.32
26_R	64_S	0.625	0.31
72_Q	80_N	0.624	0.31
38_G	60_D	0.615	0.31
76_T	80_N	0.612	0.30
19_A	84_A	0.601	0.30
58_F	82_T	0.597	0.29
67_W	83_L	0.596	0.29
40_A	47_L	0.591	0.29
11_I	17_W	0.575	0.28
26_R	62_A	0.573	0.28
31_T	37_R	0.573	0.28
11_I	74_A	0.566	0.27
63_P	88_W	0.562	0.27
51_M	60_D	0.557	0.27
46_A	67_W	0.555	0.27
3_S	10_H	0.553	0.26
46_A	58_F	0.542	0.26
48_V	52_C	0.540	0.26
46_A	60_D	0.517	0.24
63_P	78_L	0.512	0.24
55_T	59_F	0.510	0.24
24_I	36_W	0.510	0.24
18_I	35_A	0.507	0.24
6_T	10_H	0.507	0.24
27_Y	31_T	0.506	0.24
32_G	37_R	0.504	0.23
11_I	62_A	0.501	0.23
2_L	10_H	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rzeA	1	0.3034	3.4	0.944	Contact Map
4n4rB	1	0.3708	2.9	0.947	Contact Map
3vw7A	1	0.4382	2.9	0.947	Contact Map
2rh1A	1	0.3146	2.7	0.948	Contact Map
2hi7B	1	0.236	2.7	0.948	Contact Map
4ogqG	1	0.4157	2	0.951	Contact Map
4mbsA	1	0.4157	1.9	0.951	Contact Map
1q90G	1	0.3371	1.9	0.952	Contact Map
2qjvA	4	0.4719	1.6	0.954	Contact Map
4mxeA	4	0.3371	1.6	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.