DUF2492 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2492 - Protein of unknown function (DUF2492)

PFAM:	PF10678	Sequences: DSIHGHEVLNMMIESGEQYTHASLEAAIKARFGEQARFHTCSAEGMTAGELVAFLAAKGKFIPSKDGFSTDQSKICR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	77 (76)
Sequences:	896 (638)
Seq/√Len:	73.1
META:	0.768

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_E	49_G	4.193	1.00
28_I	38_F	2.968	1.00
2_S	39_H	2.948	1.00
17_E	27_A	2.452	1.00
3_I	36_A	2.437	1.00
25_E	52_V	2.126	1.00
47_T	50_E	2.010	1.00
10_N	14_E	1.922	1.00
21_H	53_A	1.910	1.00
71_D	74_K	1.901	1.00
70_T	75_I	1.834	1.00
40_T	46_M	1.744	1.00
5_G	40_T	1.621	0.99
9_L	70_T	1.604	0.99
53_A	57_A	1.498	0.99
21_H	56_A	1.490	0.99
46_M	50_E	1.485	0.99
2_S	45_G	1.451	0.99
7_E	10_N	1.371	0.98
5_G	51_L	1.368	0.98
39_H	46_M	1.342	0.98
8_V	51_L	1.331	0.98
19_Y	23_S	1.331	0.98
19_Y	27_A	1.302	0.98
28_I	48_A	1.297	0.97
5_G	48_A	1.292	0.97
62_I	70_T	1.239	0.97
12_M	61_F	1.152	0.95
56_A	63_P	1.148	0.95
40_T	43_A	1.142	0.95
74_K	77_R	1.140	0.95
52_V	61_F	1.105	0.94
48_A	52_V	1.080	0.93
6_H	9_L	1.071	0.93
70_T	74_K	1.055	0.92
2_S	44_E	1.048	0.92
12_M	16_G	1.048	0.92
40_T	51_L	1.044	0.92
37_R	47_T	1.034	0.91
8_V	28_I	1.015	0.90
63_P	66_D	1.003	0.90
43_A	46_M	1.003	0.90
26_A	30_A	0.998	0.90
23_S	68_F	0.920	0.86
37_R	45_G	0.905	0.85
11_M	27_A	0.900	0.84
53_A	64_S	0.899	0.84
66_D	77_R	0.872	0.82
15_S	19_Y	0.866	0.82
28_I	61_F	0.865	0.82
11_M	15_S	0.864	0.82
22_A	26_A	0.847	0.80
63_P	67_G	0.838	0.80
55_L	60_K	0.828	0.79
19_Y	38_F	0.828	0.79
9_L	12_M	0.827	0.79
11_M	19_Y	0.818	0.78
22_A	25_E	0.818	0.78
21_H	63_P	0.808	0.77
10_N	75_I	0.787	0.75
13_I	70_T	0.780	0.75
63_P	68_F	0.779	0.75
64_S	73_S	0.773	0.74
72_Q	75_I	0.762	0.73
25_E	29_K	0.758	0.73
5_G	43_A	0.744	0.71
49_G	52_V	0.741	0.71
29_K	49_G	0.734	0.70
40_T	45_G	0.721	0.69
21_H	68_F	0.718	0.69
14_E	31_R	0.711	0.68
8_V	48_A	0.703	0.67
2_S	29_K	0.701	0.67
2_S	36_A	0.700	0.67
71_D	75_I	0.694	0.66
30_A	65_K	0.691	0.66
34_E	66_D	0.679	0.64
47_T	51_L	0.653	0.61
40_T	54_F	0.643	0.60
29_K	34_E	0.638	0.59
37_R	40_T	0.634	0.59
22_A	66_D	0.619	0.57
23_S	26_A	0.611	0.56
69_S	74_K	0.602	0.55
8_V	74_K	0.595	0.54
32_F	38_F	0.593	0.54
56_A	61_F	0.584	0.53
19_Y	28_I	0.577	0.52
48_A	61_F	0.574	0.52
42_S	55_L	0.570	0.51
21_H	32_F	0.567	0.51
13_I	75_I	0.566	0.51
39_H	45_G	0.559	0.50
65_K	77_R	0.558	0.50
29_K	64_S	0.545	0.48
64_S	67_G	0.539	0.47
19_Y	24_L	0.539	0.47
15_S	18_Q	0.539	0.47
23_S	27_A	0.536	0.47
8_V	16_G	0.535	0.47
42_S	58_K	0.529	0.46
9_L	75_I	0.525	0.46
9_L	14_E	0.524	0.45
10_N	20_T	0.521	0.45
50_E	53_A	0.517	0.45
17_E	31_R	0.514	0.44
51_L	55_L	0.514	0.44
11_M	28_I	0.513	0.44
5_G	8_V	0.511	0.44
30_A	57_A	0.511	0.44
20_T	23_S	0.509	0.44
46_M	54_F	0.507	0.43
45_G	64_S	0.500	0.42
17_E	35_Q	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4trbA	2	0.7013	36.8	0.872	Contact Map
3g2bA	2	0.7143	30.4	0.877	Contact Map
2zo4A	1	0.7792	29.7	0.878	Contact Map
3dp7A	2	0.8312	20	0.888	Contact Map
2heoA	1	0.7662	15.2	0.893	Contact Map
3n75A	4	0.961	14.7	0.894	Contact Map
4y66A	1	0.8182	14.1	0.895	Contact Map
4ad9A	4	0.8831	13.5	0.896	Contact Map
1c4kA	2	1	13	0.897	Contact Map
4etsA	2	0.9091	12	0.898	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.