DUF2478 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2478 - Protein of unknown function (DUF2478)

PFAM:	PF10649	Sequences: IAAVVYAPGGGKDTLLARFAERLRARGLRVGGVVQRNVRRADGRRCGMDLRDLATGERIRISQDLGPGARGCRLDPAALAEAAAAVERALAAGADLVIVNKFGKLEAEGRGFRDAIAEALAAGIPVLTAVPERNLDAWRAFAGGLAVELPPDRDALLAW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	159 (158)
Sequences:	2862 (2188)
Seq/√Len:	174.1
META:	0.843

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
49_D	58_R	3.467	1.00
20_A	98_I	3.306	1.00
19_F	156_L	2.887	1.00
29_R	95_D	2.759	1.00
139_R	148_E	2.758	1.00
28_L	95_D	2.727	1.00
36_R	51_R	2.721	1.00
135_L	139_R	2.577	1.00
77_A	81_E	2.321	1.00
152_D	155_A	2.287	1.00
30_V	96_L	2.287	1.00
52_D	55_T	2.208	1.00
51_R	58_R	2.153	1.00
13_D	101_K	2.030	1.00
118_E	122_A	2.028	1.00
22_R	157_L	2.014	1.00
153_R	157_L	1.972	1.00
87_E	118_E	1.968	1.00
65_L	69_A	1.928	1.00
31_G	94_A	1.905	1.00
22_R	153_R	1.878	1.00
86_V	90_L	1.873	1.00
13_D	37_N	1.833	1.00
96_L	127_L	1.816	1.00
33_V	50_L	1.812	1.00
104_K	134_N	1.752	1.00
86_V	89_A	1.748	1.00
49_D	60_R	1.689	1.00
118_E	121_A	1.653	1.00
59_I	78_A	1.602	1.00
154_D	157_L	1.596	1.00
136_D	140_A	1.588	1.00
7_A	132_E	1.575	1.00
22_R	26_R	1.569	1.00
52_D	57_E	1.560	1.00
34_V	53_L	1.499	1.00
116_I	128_T	1.497	1.00
63_Q	66_G	1.485	1.00
87_E	115_A	1.478	1.00
104_K	108_E	1.463	1.00
82_A	112_F	1.438	1.00
23_L	28_L	1.425	1.00
48_M	62_S	1.420	1.00
14_T	18_R	1.384	1.00
20_A	24_R	1.382	1.00
154_D	158_A	1.368	1.00
75_D	78_A	1.321	1.00
66_G	69_A	1.288	1.00
17_A	36_R	1.287	1.00
37_N	48_M	1.280	1.00
107_A	137_A	1.261	1.00
66_G	72_C	1.246	1.00
97_V	119_A	1.245	1.00
150_P	155_A	1.244	1.00
17_A	21_E	1.237	1.00
36_R	58_R	1.237	1.00
2_A	149_L	1.233	1.00
23_L	96_L	1.229	1.00
74_L	105_L	1.226	1.00
15_L	19_F	1.221	1.00
16_L	98_I	1.202	1.00
13_D	100_N	1.188	1.00
7_A	10_G	1.185	1.00
81_E	85_A	1.183	1.00
101_K	129_A	1.176	1.00
97_V	124_I	1.157	1.00
76_P	80_A	1.155	1.00
19_F	157_L	1.155	1.00
21_E	24_R	1.144	1.00
142_A	146_A	1.143	1.00
80_A	111_G	1.139	1.00
140_A	143_G	1.099	1.00
6_Y	12_K	1.074	1.00
20_A	34_V	1.070	1.00
57_E	81_E	1.064	1.00
38_V	47_G	1.061	1.00
18_R	153_R	1.058	1.00
63_Q	69_A	1.035	0.99
155_A	158_A	1.030	0.99
6_Y	101_K	1.014	0.99
136_D	139_R	1.011	0.99
17_A	34_V	0.997	0.99
3_A	6_Y	0.994	0.99
142_A	145_L	0.993	0.99
135_L	148_E	0.993	0.99
11_G	14_T	0.991	0.99
33_V	86_V	0.989	0.99
79_L	105_L	0.975	0.99
78_A	81_E	0.964	0.99
7_A	11_G	0.953	0.99
91_A	118_E	0.937	0.99
102_F	128_T	0.933	0.99
69_A	72_C	0.915	0.99
147_V	157_L	0.904	0.99
8_P	11_G	0.899	0.98
5_V	148_E	0.889	0.98
85_A	89_A	0.888	0.98
19_F	127_L	0.887	0.98
45_R	48_M	0.887	0.98
55_T	58_R	0.871	0.98
145_L	148_E	0.866	0.98
99_V	116_I	0.864	0.98
113_R	117_A	0.858	0.98
40_R	43_G	0.852	0.98
96_L	124_I	0.844	0.98
98_I	127_L	0.831	0.97
80_A	83_A	0.829	0.97
52_D	89_A	0.829	0.97
119_A	126_V	0.817	0.97
24_R	51_R	0.799	0.97
33_V	115_A	0.794	0.97
74_L	79_L	0.793	0.97
131_P	134_N	0.789	0.97
85_A	88_R	0.789	0.97
117_A	121_A	0.787	0.96
65_L	71_G	0.781	0.96
84_A	88_R	0.777	0.96
90_L	97_V	0.773	0.96
21_E	25_A	0.771	0.96
22_R	25_A	0.766	0.96
35_Q	104_K	0.764	0.96
24_R	30_V	0.758	0.96
4_V	15_L	0.757	0.96
12_K	100_N	0.755	0.96
114_D	118_E	0.755	0.96
13_D	16_L	0.752	0.95
19_F	98_I	0.751	0.95
12_K	101_K	0.750	0.95
15_L	153_R	0.749	0.95
117_A	120_L	0.745	0.95
76_P	105_L	0.743	0.95
150_P	158_A	0.741	0.95
105_L	110_R	0.737	0.95
35_Q	119_A	0.737	0.95
148_E	153_R	0.735	0.95
61_I	78_A	0.728	0.95
86_V	112_F	0.728	0.95
4_V	12_K	0.726	0.94
101_K	138_W	0.719	0.94
59_I	85_A	0.714	0.94
150_P	153_R	0.711	0.94
138_W	142_A	0.708	0.94
103_G	106_E	0.703	0.94
63_Q	73_R	0.694	0.93
147_V	150_P	0.693	0.93
35_Q	112_F	0.692	0.93
131_P	142_A	0.690	0.93
105_L	108_E	0.689	0.93
31_G	54_A	0.685	0.93
145_L	149_L	0.681	0.92
68_G	72_C	0.676	0.92
101_K	117_A	0.676	0.92
13_D	35_Q	0.672	0.92
60_R	63_Q	0.668	0.92
16_L	23_L	0.667	0.92
90_L	122_A	0.664	0.91
50_L	54_A	0.661	0.91
43_G	157_L	0.661	0.91
62_S	65_L	0.660	0.91
145_L	158_A	0.656	0.91
83_A	112_F	0.649	0.90
65_L	73_R	0.645	0.90
73_R	100_N	0.640	0.90
35_Q	97_V	0.640	0.90
87_E	91_A	0.636	0.90
33_V	85_A	0.631	0.89
90_L	124_I	0.630	0.89
30_V	97_V	0.629	0.89
25_A	56_G	0.627	0.89
153_R	158_A	0.627	0.89
49_D	63_Q	0.624	0.89
65_L	68_G	0.623	0.89
69_A	74_L	0.622	0.89
100_N	107_A	0.620	0.88
111_G	114_D	0.618	0.88
6_Y	11_G	0.618	0.88
12_K	15_L	0.617	0.88
97_V	122_A	0.615	0.88
106_E	111_G	0.614	0.88
26_R	157_L	0.613	0.88
39_R	47_G	0.612	0.88
5_V	12_K	0.609	0.88
130_V	138_W	0.602	0.87
51_R	56_G	0.598	0.87
12_K	131_P	0.598	0.87
66_G	73_R	0.598	0.87
40_R	47_G	0.595	0.86
99_V	115_A	0.588	0.86
9_G	12_K	0.586	0.85
16_L	129_A	0.580	0.85
147_V	151_P	0.575	0.84
33_V	52_D	0.573	0.84
15_L	151_P	0.572	0.84
138_W	146_A	0.571	0.84
69_A	73_R	0.570	0.84
105_L	131_P	0.570	0.84
80_A	84_A	0.569	0.84
35_Q	109_G	0.569	0.84
48_M	59_I	0.568	0.84
57_E	85_A	0.568	0.84
86_V	115_A	0.567	0.84
6_Y	131_P	0.564	0.83
23_L	26_R	0.564	0.83
150_P	156_L	0.562	0.83
139_R	142_A	0.561	0.83
130_V	135_L	0.559	0.83
147_V	154_D	0.557	0.82
114_D	123_G	0.557	0.82
63_Q	108_E	0.555	0.82
31_G	115_A	0.553	0.82
80_A	110_R	0.550	0.82
93_G	122_A	0.545	0.81
84_A	87_E	0.545	0.81
83_A	87_E	0.542	0.81
151_P	156_L	0.541	0.81
128_T	131_P	0.541	0.81
78_A	82_A	0.540	0.81
3_A	9_G	0.537	0.80
49_D	110_R	0.535	0.80
148_E	154_D	0.533	0.80
35_Q	101_K	0.528	0.79
150_P	157_L	0.523	0.78
72_C	119_A	0.520	0.78
99_V	142_A	0.518	0.78
93_G	124_I	0.517	0.78
39_R	45_R	0.513	0.77
18_R	21_E	0.510	0.77
21_E	51_R	0.510	0.77
107_A	134_N	0.508	0.76
15_L	156_L	0.508	0.76
143_G	146_A	0.507	0.76
50_L	79_L	0.506	0.76
148_E	156_L	0.505	0.76
156_L	159_W	0.503	0.76
5_V	9_G	0.502	0.76
83_A	115_A	0.502	0.76
33_V	101_K	0.500	0.75

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xx6A	4	0.805	98.6	0.761	Contact Map
3e2iA	3	0.7673	98.6	0.762	Contact Map
2j9rA	3	0.7421	98.6	0.762	Contact Map
2b8tA	3	0.8679	98.5	0.767	Contact Map
2r8rA	1	0.8931	98.2	0.786	Contact Map
2vhjA	3	0.7484	98.2	0.786	Contact Map
3jvvA	3	0.805	98.1	0.791	Contact Map
2ewvA	3	0.8239	98.1	0.792	Contact Map
3bosA	2	0.7358	98.1	0.793	Contact Map
1ye8A	1	0.9371	98	0.796	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.