CsgE - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CsgE - Curli assembly protein CsgE

PFAM:	PF10627	Sequences: IDGLVIDETITKIGRDFYDYFYSKWRAPPGASNFTITIKERPSAGRGTQIWVEVNDKVVYQFFLQPRYDYIEEMAEQAVRRVYQYLQNLELQKKLLDTPDLARDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	105 (97)
Sequences:	992 (723)
Seq/√Len:	73.5
META:	0.716

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_D	15_R	3.399	1.00
12_K	16_D	3.226	1.00
21_F	82_V	3.067	1.00
90_E	93_K	2.826	1.00
60_Y	78_A	2.711	1.00
39_K	53_E	2.599	1.00
24_K	76_E	2.333	1.00
75_A	79_V	2.032	1.00
44_A	47_G	1.984	1.00
8_E	39_K	1.955	1.00
49_Q	61_Q	1.922	1.00
5_V	22_Y	1.808	1.00
54_V	85_Y	1.785	1.00
6_I	37_T	1.761	1.00
58_V	61_Q	1.745	1.00
54_V	82_V	1.720	1.00
20_Y	68_Y	1.682	1.00
16_D	20_Y	1.668	1.00
43_S	47_G	1.654	1.00
20_Y	72_E	1.651	1.00
41_R	51_W	1.560	0.99
51_W	58_V	1.487	0.99
13_I	47_G	1.484	0.99
21_F	38_I	1.480	0.99
1_I	4_L	1.417	0.99
10_I	41_R	1.412	0.99
53_E	58_V	1.397	0.98
81_R	84_Q	1.382	0.98
43_S	46_R	1.366	0.98
84_Q	87_Q	1.331	0.98
84_Q	88_N	1.307	0.98
60_Y	74_M	1.299	0.98
41_R	49_Q	1.281	0.97
20_Y	75_A	1.280	0.97
39_K	51_W	1.229	0.97
2_D	31_A	1.186	0.96
32_S	36_I	1.184	0.96
28_P	34_F	1.157	0.95
20_Y	71_I	1.106	0.94
24_K	79_V	1.102	0.94
52_V	57_K	1.079	0.93
55_N	89_L	1.068	0.93
15_R	19_D	1.065	0.92
8_E	37_T	1.059	0.92
5_V	36_I	1.050	0.92
60_Y	77_Q	1.044	0.92
10_I	14_G	1.018	0.91
12_K	22_Y	1.006	0.90
20_Y	69_D	0.997	0.90
95_L	98_T	0.966	0.88
16_D	72_E	0.958	0.88
44_A	48_T	0.938	0.87
65_Q	69_D	0.936	0.87
6_I	43_S	0.928	0.86
34_F	42_P	0.925	0.86
36_I	54_V	0.923	0.86
92_Q	96_L	0.922	0.86
1_I	15_R	0.911	0.85
42_P	49_Q	0.906	0.85
7_D	11_T	0.887	0.84
47_G	51_W	0.885	0.83
60_Y	81_R	0.885	0.83
74_M	79_V	0.853	0.81
18_Y	22_Y	0.850	0.81
11_T	48_T	0.849	0.81
30_G	37_T	0.845	0.80
73_E	76_E	0.838	0.80
50_I	72_E	0.836	0.80
16_D	22_Y	0.831	0.79
10_I	42_P	0.826	0.79
92_Q	95_L	0.821	0.79
56_D	94_K	0.810	0.78
88_N	91_L	0.804	0.77
25_W	28_P	0.803	0.77
18_Y	21_F	0.794	0.76
48_T	89_L	0.781	0.75
45_G	56_D	0.769	0.74
28_P	31_A	0.767	0.74
34_F	55_N	0.765	0.73
85_Y	89_L	0.756	0.73
83_Y	87_Q	0.754	0.72
1_I	14_G	0.723	0.69
52_V	59_V	0.720	0.69
21_F	36_I	0.701	0.67
91_L	95_L	0.700	0.67
4_L	55_N	0.696	0.66
19_D	66_P	0.693	0.66
15_R	63_F	0.690	0.66
81_R	88_N	0.686	0.65
41_R	48_T	0.686	0.65
11_T	77_Q	0.686	0.65
71_I	89_L	0.684	0.65
12_K	15_R	0.683	0.65
2_D	75_A	0.677	0.64
67_R	70_Y	0.674	0.64
31_A	55_N	0.672	0.64
33_N	90_E	0.666	0.63
7_D	13_I	0.665	0.63
25_W	90_E	0.655	0.62
53_E	57_K	0.646	0.61
24_K	27_A	0.646	0.61
60_Y	83_Y	0.645	0.60
49_Q	65_Q	0.637	0.59
28_P	80_R	0.637	0.59
3_G	18_Y	0.637	0.59
59_V	82_V	0.633	0.59
77_Q	81_R	0.623	0.58
25_W	64_L	0.622	0.58
2_D	32_S	0.620	0.57
30_G	79_V	0.618	0.57
32_S	82_V	0.617	0.57
23_S	64_L	0.616	0.57
57_K	72_E	0.612	0.56
19_D	36_I	0.609	0.56
25_W	30_G	0.595	0.54
13_I	64_L	0.593	0.54
78_A	82_V	0.593	0.54
14_G	17_F	0.589	0.54
64_L	77_Q	0.581	0.53
73_E	77_Q	0.580	0.52
77_Q	80_R	0.579	0.52
25_W	44_A	0.576	0.52
17_F	59_V	0.573	0.52
89_L	96_L	0.566	0.51
49_Q	53_E	0.565	0.51
65_Q	70_Y	0.562	0.50
30_G	47_G	0.559	0.50
11_T	14_G	0.558	0.50
25_W	34_F	0.554	0.49
5_V	25_W	0.551	0.49
28_P	79_V	0.551	0.49
32_S	86_L	0.545	0.48
9_T	82_V	0.537	0.47
62_F	77_Q	0.535	0.47
46_R	63_F	0.533	0.47
55_N	71_I	0.532	0.47
52_V	92_Q	0.526	0.46
91_L	94_K	0.520	0.45
21_F	64_L	0.520	0.45
87_Q	91_L	0.520	0.45
43_S	68_Y	0.517	0.45
46_R	66_P	0.517	0.45
25_W	38_I	0.508	0.44
36_I	62_F	0.503	0.43
12_K	72_E	0.502	0.43
2_D	55_N	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3dwcA	3	0.9333	19.7	0.908	Contact Map
3ugfA	2	0.9048	14.8	0.913	Contact Map
2ac1A	1	0.8762	13.5	0.915	Contact Map
4c3xA	4	0.8952	11.7	0.917	Contact Map
2lfcA	1	0.8381	10.4	0.919	Contact Map
2o34A	1	0.7429	8	0.923	Contact Map
1st8A	1	0.9048	7.6	0.924	Contact Map
1gyxA	2	0.6571	7.6	0.924	Contact Map
3sksA	1	0.9333	7.3	0.924	Contact Map
4pwwA	2	0.4381	6.4	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.