Tail_tube - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Tail_tube - Phage tail tube protein

PFAM:	PF10618	Sequences: MNRIAGTAYIKVDGEQLPLKGGFTYNPGGVKRETVVGQDGVHGYKETPRAPYIEGTITDTGDLDLEDLNAITDATVTAELANGKTYVLRNAWVTGEPEVNTEEGEIEVRFEGLSCEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	117 (114)
Sequences:	1488 (1212)
Seq/√Len:	113.5
META:	0.799

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_I	74_A	3.140	1.00
56_T	105_E	2.818	1.00
33_E	47_T	2.365	1.00
52_Y	109_R	2.274	1.00
54_E	109_R	2.264	1.00
73_D	90_N	2.139	1.00
32_R	46_E	2.028	1.00
33_E	45_K	2.022	1.00
34_T	111_E	1.922	1.00
36_V	50_A	1.903	1.00
64_D	67_D	1.902	1.00
34_T	92_W	1.790	1.00
24_T	98_E	1.788	1.00
31_K	47_T	1.777	1.00
15_E	67_D	1.751	1.00
20_K	105_E	1.741	1.00
9_Y	79_E	1.723	1.00
88_L	91_A	1.651	1.00
39_D	42_H	1.649	1.00
37_G	42_H	1.645	1.00
34_T	50_A	1.642	1.00
26_N	52_Y	1.590	1.00
26_N	98_E	1.587	1.00
56_T	107_E	1.579	1.00
24_T	54_E	1.558	1.00
20_K	58_T	1.538	1.00
54_E	107_E	1.532	1.00
79_E	85_T	1.504	1.00
42_H	58_T	1.483	1.00
22_G	56_T	1.443	1.00
88_L	112_G	1.441	1.00
76_V	110_F	1.414	1.00
95_G	109_R	1.413	1.00
41_V	92_W	1.410	1.00
31_K	49_R	1.395	1.00
4_I	18_P	1.380	1.00
31_K	96_E	1.348	1.00
13_D	74_A	1.332	1.00
59_D	84_K	1.314	1.00
23_F	55_G	1.314	1.00
100_N	105_E	1.308	1.00
30_V	46_E	1.292	0.99
11_K	16_Q	1.271	0.99
25_Y	86_Y	1.266	0.99
26_N	49_R	1.263	0.99
24_T	100_N	1.251	0.99
94_T	111_E	1.197	0.99
31_K	95_G	1.171	0.99
93_V	97_P	1.153	0.99
77_T	85_T	1.127	0.99
38_Q	101_T	1.126	0.99
51_P	88_L	1.123	0.99
37_G	43_G	1.110	0.98
11_K	79_E	1.096	0.98
19_L	55_G	1.089	0.98
66_E	70_A	1.075	0.98
23_F	78_A	1.045	0.98
52_Y	111_E	1.040	0.98
9_Y	16_Q	1.037	0.97
22_G	102_E	1.030	0.97
93_V	108_V	1.025	0.97
51_P	113_L	1.017	0.97
25_Y	78_A	1.015	0.97
34_T	94_T	0.980	0.96
8_A	19_L	0.980	0.96
53_I	88_L	0.972	0.96
53_I	78_A	0.968	0.96
71_I	110_F	0.955	0.96
32_R	72_T	0.951	0.96
12_V	17_L	0.936	0.95
36_V	41_V	0.934	0.95
49_R	96_E	0.926	0.95
4_I	60_T	0.919	0.95
18_P	60_T	0.907	0.95
45_K	102_E	0.899	0.94
4_I	35_V	0.895	0.94
27_P	115_C	0.892	0.94
5_A	59_D	0.892	0.94
8_A	76_V	0.887	0.94
53_I	112_G	0.870	0.93
4_I	58_T	0.870	0.93
11_K	77_T	0.868	0.93
88_L	115_C	0.858	0.93
19_L	23_F	0.854	0.93
35_V	58_T	0.842	0.92
32_R	44_Y	0.838	0.92
2_N	72_T	0.836	0.92
35_V	45_K	0.819	0.91
50_A	111_E	0.808	0.90
3_R	81_A	0.802	0.90
90_N	113_L	0.802	0.90
46_E	72_T	0.798	0.90
10_I	55_G	0.794	0.90
51_P	115_C	0.792	0.90
65_L	106_I	0.791	0.89
20_K	56_T	0.787	0.89
7_T	38_Q	0.785	0.89
51_P	112_G	0.783	0.89
59_D	82_N	0.781	0.89
44_Y	92_W	0.772	0.88
20_K	35_V	0.770	0.88
59_D	99_V	0.759	0.87
22_G	100_N	0.755	0.87
59_D	63_L	0.749	0.87
99_V	106_I	0.733	0.86
77_T	87_V	0.730	0.85
76_V	91_A	0.723	0.85
27_P	86_Y	0.720	0.85
69_N	97_P	0.717	0.84
38_Q	48_P	0.716	0.84
28_G	51_P	0.715	0.84
12_V	71_I	0.701	0.83
34_T	41_V	0.697	0.83
56_T	100_N	0.685	0.82
3_R	7_T	0.684	0.81
53_I	76_V	0.683	0.81
86_Y	115_C	0.682	0.81
13_D	67_D	0.675	0.81
100_N	103_E	0.674	0.80
44_Y	72_T	0.672	0.80
3_R	46_E	0.667	0.80
46_E	92_W	0.666	0.80
10_I	57_I	0.662	0.79
69_N	93_V	0.659	0.79
29_G	69_N	0.646	0.78
71_I	93_V	0.642	0.77
9_Y	77_T	0.637	0.77
36_V	48_P	0.633	0.76
5_A	104_G	0.628	0.76
47_T	102_E	0.619	0.75
59_D	106_I	0.612	0.74
13_D	71_I	0.608	0.73
37_G	58_T	0.603	0.73
68_L	71_I	0.603	0.73
55_G	110_F	0.602	0.73
28_G	115_C	0.589	0.71
25_Y	99_V	0.584	0.70
92_W	111_E	0.578	0.69
93_V	110_F	0.576	0.69
78_A	86_Y	0.576	0.69
80_L	86_Y	0.571	0.69
26_N	96_E	0.571	0.69
32_R	92_W	0.570	0.68
23_F	57_I	0.565	0.68
38_Q	47_T	0.565	0.68
98_E	107_E	0.563	0.67
16_Q	77_T	0.562	0.67
89_R	114_S	0.560	0.67
28_G	97_P	0.560	0.67
63_L	68_L	0.556	0.67
50_A	94_T	0.555	0.66
17_L	57_I	0.550	0.66
57_I	108_V	0.549	0.66
37_G	41_V	0.546	0.65
27_P	65_L	0.544	0.65
12_V	74_A	0.538	0.64
52_Y	98_E	0.533	0.63
30_V	48_P	0.532	0.63
7_T	30_V	0.526	0.62
54_E	111_E	0.526	0.62
8_A	23_F	0.525	0.62
97_P	108_V	0.523	0.62
63_L	106_I	0.521	0.62
26_N	109_R	0.518	0.61
8_A	78_A	0.516	0.61
5_A	35_V	0.515	0.61
17_L	108_V	0.515	0.61
91_A	115_C	0.511	0.60
55_G	108_V	0.510	0.60
100_N	107_E	0.503	0.59
64_D	84_K	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q1zA	1	0.5214	16.4	0.902	Contact Map
4aynA	2	0.7179	11.7	0.908	Contact Map
2x8kA	5	0.906	11	0.909	Contact Map
4xinA	2	0.906	9	0.913	Contact Map
2vf1A	10	0.8889	9	0.913	Contact Map
1v7wA	2	0.3162	7.1	0.917	Contact Map
2ypvA	1	0.906	5.7	0.92	Contact Map
1r6vA	1	0.4786	5.7	0.92	Contact Map
3w7tA	1	0.9487	5.2	0.922	Contact Map
2lfuA	1	0.4872	4.9	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.