MTP18 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MTP18 - Mitochondrial 18 KDa protein (MTP18)

PFAM:	PF10558	Sequences: SNVRYAAYAARLRTILLSAHRYLAYTSDVGEAFRPVVPPWLVRAAYGVSWAYVLGDVADEGYKAYLRNQRPLEPTPGLKPGHVPPLEDVRVVMVDRAVFQSLASMALPAFTIHSIVAYSGKALKNAKNPRLRTWGPTALGLAVIPFLPYPIDEPVEHAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	159 (142)
Sequences:	502 (303)
Seq/√Len:	25.4
META:	0.333

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_G	93_M	5.767	1.00
115_I	143_V	5.008	1.00
116_V	136_P	3.799	1.00
40_W	43_R	3.357	1.00
119_S	139_L	2.937	1.00
34_R	42_V	2.508	0.99
47_G	51_A	2.383	0.98
147_L	150_P	2.346	0.98
24_A	27_S	2.338	0.98
84_P	87_E	2.275	0.98
119_S	123_L	2.264	0.98
44_A	47_G	2.262	0.98
33_F	100_Q	2.160	0.97
59_D	63_K	2.145	0.97
99_F	156_E	2.128	0.97
50_W	101_S	2.023	0.95
58_A	61_G	1.852	0.93
22_Y	100_Q	1.804	0.92
49_S	105_M	1.694	0.89
123_L	135_G	1.637	0.87
61_G	65_Y	1.635	0.87
107_L	151_I	1.628	0.87
117_A	121_K	1.620	0.87
151_I	155_V	1.576	0.85
148_P	154_P	1.557	0.84
32_A	142_A	1.534	0.83
32_A	137_T	1.533	0.83
49_S	111_T	1.437	0.79
22_Y	45_A	1.433	0.79
45_A	49_S	1.401	0.77
105_M	109_A	1.393	0.77
64_A	67_R	1.382	0.76
113_H	116_V	1.382	0.76
100_Q	155_V	1.365	0.75
14_T	18_S	1.341	0.74
147_L	154_P	1.325	0.73
70_R	89_V	1.321	0.73
35_P	136_P	1.290	0.71
54_L	58_A	1.287	0.71
37_V	41_L	1.277	0.70
22_Y	33_F	1.259	0.69
153_E	157_H	1.257	0.69
60_E	63_K	1.238	0.68
50_W	54_L	1.229	0.67
145_P	152_D	1.226	0.67
24_A	28_D	1.213	0.66
107_L	155_V	1.213	0.66
49_S	153_E	1.202	0.65
27_S	105_M	1.171	0.63
24_A	99_F	1.158	0.63
10_A	15_I	1.150	0.62
128_N	132_R	1.141	0.61
32_A	101_S	1.117	0.60
34_R	110_F	1.107	0.59
10_A	14_T	1.106	0.59
99_F	148_P	1.094	0.58
39_P	43_R	1.075	0.57
148_P	151_I	1.074	0.57
27_S	113_H	1.073	0.57
100_Q	105_M	1.049	0.55
62_Y	122_A	1.032	0.54
94_V	119_S	1.021	0.53
82_H	86_L	1.014	0.52
61_G	89_V	1.012	0.52
101_S	106_A	1.012	0.52
39_P	44_A	1.001	0.51
98_V	124_K	0.996	0.51
27_S	100_Q	0.994	0.51
72_L	130_R	0.988	0.50
64_A	92_V	0.976	0.49
98_V	110_F	0.958	0.48
28_D	144_I	0.957	0.48
24_A	100_Q	0.956	0.48
13_R	149_Y	0.955	0.48
57_V	61_G	0.927	0.46
10_A	17_L	0.925	0.46
49_S	109_A	0.924	0.46
141_L	145_P	0.917	0.45
20_H	23_L	0.914	0.45
84_P	88_D	0.912	0.45
39_P	136_P	0.911	0.45
12_L	16_L	0.910	0.45
12_L	15_I	0.908	0.45
23_L	102_L	0.905	0.44
38_P	43_R	0.901	0.44
64_A	69_Q	0.898	0.44
38_P	142_A	0.892	0.43
100_Q	140_G	0.888	0.43
90_R	97_A	0.877	0.42
48_V	59_D	0.877	0.42
37_V	53_V	0.866	0.42
115_I	119_S	0.857	0.41
107_L	113_H	0.857	0.41
50_W	105_M	0.852	0.41
90_R	93_M	0.852	0.41
86_L	93_M	0.845	0.40
61_G	101_S	0.843	0.40
51_A	153_E	0.837	0.39
106_A	110_F	0.834	0.39
39_P	116_V	0.834	0.39
32_A	90_R	0.827	0.39
35_P	50_W	0.819	0.38
73_E	85_P	0.817	0.38
54_L	98_V	0.816	0.38
10_A	98_V	0.809	0.38
47_G	66_L	0.806	0.37
54_L	97_A	0.798	0.37
140_G	145_P	0.794	0.37
82_H	85_P	0.790	0.36
28_D	147_L	0.787	0.36
24_A	109_A	0.783	0.36
129_P	135_G	0.783	0.36
71_P	158_A	0.779	0.36
22_Y	148_P	0.778	0.35
114_S	118_Y	0.773	0.35
100_Q	109_A	0.762	0.34
93_M	156_E	0.754	0.34
148_P	156_E	0.752	0.34
12_L	40_W	0.744	0.33
50_W	98_V	0.743	0.33
131_L	146_F	0.735	0.33
104_S	112_I	0.731	0.32
33_F	111_T	0.729	0.32
54_L	106_A	0.725	0.32
25_Y	30_G	0.725	0.32
27_S	109_A	0.724	0.32
48_V	63_K	0.724	0.32
10_A	13_R	0.722	0.32
59_D	97_A	0.710	0.31
69_Q	73_E	0.709	0.31
141_L	152_D	0.709	0.31
29_V	131_L	0.699	0.30
43_R	50_W	0.696	0.30
27_S	57_V	0.689	0.30
146_F	155_V	0.684	0.29
137_T	140_G	0.679	0.29
110_F	114_S	0.675	0.29
144_I	151_I	0.669	0.29
24_A	45_A	0.669	0.29
36_V	134_W	0.661	0.28
13_R	17_L	0.658	0.28
135_G	139_L	0.657	0.28
10_A	16_L	0.656	0.28
85_P	130_R	0.654	0.28
147_L	151_I	0.654	0.28
121_K	124_K	0.652	0.28
33_F	141_L	0.650	0.27
110_F	113_H	0.648	0.27
25_Y	104_S	0.640	0.27
81_G	84_P	0.638	0.27
71_P	81_G	0.637	0.27
40_W	86_L	0.635	0.27
98_V	131_L	0.631	0.26
24_A	105_M	0.628	0.26
32_A	100_Q	0.622	0.26
68_N	89_V	0.620	0.26
33_F	137_T	0.620	0.26
110_F	143_V	0.619	0.26
109_A	150_P	0.611	0.25
99_F	109_A	0.611	0.25
65_Y	137_T	0.603	0.25
30_G	46_Y	0.602	0.25
65_Y	89_V	0.600	0.25
11_R	14_T	0.598	0.24
29_V	133_T	0.593	0.24
37_V	114_S	0.591	0.24
98_V	102_L	0.590	0.24
45_A	109_A	0.590	0.24
91_V	95_D	0.585	0.24
128_N	131_L	0.580	0.24
28_D	99_F	0.579	0.23
68_N	90_R	0.579	0.23
149_Y	154_P	0.578	0.23
48_V	86_L	0.577	0.23
32_A	35_P	0.569	0.23
31_E	46_Y	0.566	0.23
51_A	66_L	0.562	0.23
11_R	15_I	0.558	0.22
99_F	154_P	0.558	0.22
114_S	117_A	0.557	0.22
35_P	135_G	0.557	0.22
28_D	60_E	0.555	0.22
21_R	24_A	0.553	0.22
109_A	151_I	0.553	0.22
22_Y	32_A	0.552	0.22
93_M	97_A	0.551	0.22
125_N	131_L	0.546	0.22
122_A	146_F	0.545	0.22
49_S	104_S	0.544	0.22
49_S	117_A	0.542	0.22
125_N	132_R	0.538	0.21
85_P	88_D	0.537	0.21
53_V	109_A	0.537	0.21
83_V	129_P	0.536	0.21
24_A	57_V	0.533	0.21
123_L	126_A	0.530	0.21
53_V	146_F	0.529	0.21
150_P	154_P	0.529	0.21
47_G	122_A	0.526	0.21
81_G	85_P	0.525	0.21
85_P	91_V	0.524	0.21
53_V	97_A	0.522	0.21
120_G	136_P	0.520	0.21
53_V	60_E	0.518	0.20
54_L	94_V	0.513	0.20
38_P	41_L	0.512	0.20
60_E	96_R	0.511	0.20
10_A	23_L	0.511	0.20
68_N	73_E	0.510	0.20
99_F	103_A	0.510	0.20
45_A	53_V	0.507	0.20
37_V	134_W	0.501	0.20
107_L	129_P	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c75L	1	0	7.6	0.956	Contact Map
1wvhA	1	0.2767	1.6	0.969	Contact Map
1fryA	1	0.1824	1.5	0.969	Contact Map
3nrtA	2	0.195	1.4	0.97	Contact Map
1jcnA	6	0.3648	1.4	0.97	Contact Map
1gvfA	3	0.4403	1.3	0.97	Contact Map
2cqkA	1	0.2893	1.3	0.971	Contact Map
3zv0C	2	0.3396	1.1	0.972	Contact Map
2i53A	1	0.6164	1.1	0.972	Contact Map
1irzA	1	0.3962	1	0.972	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.