MULE - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MULE - MULE transposase domain

PFAM:	PF10551	Sequences: GTYLTNKYGPLVVAAVALGVDADGRKEVLGLWVGESESAESWLEFLRGLKRRGLGGPLLVVSDGHKGLKAAIEAVFPGAPWQRCIVHKIRNVK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (78)
Sequences:	43704 (18318)
Seq/√Len:	2074.1
META:	0.879

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
62_S	81_W	4.213	1.00
86_V	90_R	3.567	1.00
39_A	70_A	3.515	1.00
43_L	74_A	2.964	1.00
43_L	75_V	2.845	1.00
47_R	75_V	2.367	1.00
39_A	43_L	2.149	1.00
39_A	74_A	2.115	1.00
21_D	25_R	2.016	1.00
60_V	72_I	2.016	1.00
43_L	47_R	1.904	1.00
48_G	52_R	1.756	1.00
64_G	83_R	1.706	1.00
32_W	45_F	1.704	1.00
32_W	48_G	1.647	1.00
21_D	27_E	1.643	1.00
60_V	79_A	1.627	1.00
69_K	81_W	1.584	1.00
62_S	72_I	1.478	1.00
36_S	41_S	1.405	1.00
34_G	41_S	1.388	1.00
17_A	45_F	1.317	1.00
73_E	81_W	1.304	1.00
48_G	51_R	1.292	1.00
85_I	89_I	1.257	1.00
32_W	44_E	1.218	1.00
62_S	69_K	1.155	1.00
38_S	41_S	1.135	1.00
69_K	73_E	1.106	1.00
50_K	76_F	1.075	1.00
59_L	80_P	1.031	1.00
70_A	74_A	1.029	1.00
59_L	82_Q	1.001	1.00
86_V	89_I	0.991	1.00
19_G	29_L	0.988	1.00
60_V	76_F	0.951	1.00
46_L	68_L	0.938	1.00
28_V	31_L	0.929	1.00
49_L	53_G	0.926	1.00
43_L	71_A	0.923	1.00
18_L	26_K	0.913	1.00
64_G	88_K	0.910	1.00
69_K	83_R	0.894	1.00
64_G	69_K	0.882	1.00
65_H	68_L	0.851	1.00
34_G	44_E	0.844	1.00
51_R	54_L	0.838	1.00
66_K	70_A	0.831	1.00
50_K	75_V	0.830	1.00
62_S	68_L	0.825	1.00
82_Q	85_I	0.823	1.00
42_W	65_H	0.821	1.00
44_E	47_R	0.820	1.00
30_G	48_G	0.819	1.00
71_A	75_V	0.814	1.00
49_L	52_R	0.788	1.00
51_R	55_G	0.765	1.00
61_V	82_Q	0.764	1.00
60_V	68_L	0.758	1.00
46_L	76_F	0.754	1.00
57_P	79_A	0.753	1.00
24_G	27_E	0.733	1.00
40_E	43_L	0.730	1.00
48_G	53_G	0.724	1.00
39_A	65_H	0.718	1.00
35_E	41_S	0.713	1.00
66_K	69_K	0.703	1.00
57_P	76_F	0.703	1.00
42_W	45_F	0.686	1.00
36_S	77_P	0.685	1.00
64_G	91_N	0.677	1.00
50_K	54_L	0.674	1.00
68_L	72_I	0.661	1.00
70_A	73_E	0.651	1.00
47_R	74_A	0.647	1.00
67_G	70_A	0.639	1.00
15_A	35_E	0.636	1.00
52_R	55_G	0.635	1.00
46_L	75_V	0.634	1.00
30_G	45_F	0.623	1.00
47_R	50_K	0.617	1.00
57_P	60_V	0.615	1.00
40_E	44_E	0.614	1.00
65_H	69_K	0.614	1.00
28_V	32_W	0.606	1.00
88_K	92_V	0.602	1.00
49_L	54_L	0.602	1.00
42_W	67_G	0.601	1.00
68_L	81_W	0.593	1.00
88_K	91_N	0.588	1.00
18_L	28_V	0.583	1.00
16_V	28_V	0.579	1.00
34_G	45_F	0.573	1.00
62_S	83_R	0.571	1.00
41_S	44_E	0.570	1.00
72_I	81_W	0.569	1.00
50_K	55_G	0.565	1.00
39_A	67_G	0.561	1.00
34_G	42_W	0.557	1.00
80_P	83_R	0.546	1.00
36_S	65_H	0.546	1.00
20_V	24_G	0.546	1.00
37_E	67_G	0.542	1.00
17_A	26_K	0.541	1.00
47_R	51_R	0.536	1.00
31_L	89_I	0.535	1.00
20_V	26_K	0.534	1.00
22_A	27_E	0.530	1.00
71_A	74_A	0.528	1.00
83_R	91_N	0.526	1.00
42_W	68_L	0.519	1.00
58_L	80_P	0.515	1.00
31_L	92_V	0.514	1.00
65_H	70_A	0.507	1.00
37_E	84_C	0.507	1.00
37_E	65_H	0.502	1.00
74_A	77_P	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bw3A	3	0.9355	29.9	0.863	Contact Map
4u7bA	2	0.9462	20.1	0.874	Contact Map
3kksA	2	0.8817	15.5	0.88	Contact Map
1bcoA	1	0.9785	15.2	0.88	Contact Map
4fcyA	4	0.9785	15	0.881	Contact Map
4fw1A	2	0.9355	14.8	0.881	Contact Map
1cxqA	2	0.9032	13.9	0.883	Contact Map
3hphA	3	0.8817	12.9	0.884	Contact Map
2nrtA	1	0.914	12.3	0.885	Contact Map
4fw2A	2	0.8817	11.3	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.