P22_AR_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

P22_AR_N - P22_AR N-terminal domain

PFAM:	PF10547	Sequences: KTVPFHGDELLAVEEDGEIYVPLKPICEALGLDWSSQRRRIKRDEVLSSGVVEITVPTDGGPQEMLCLPLDYLPGWLFGINPNRVKPELREKLIRYQRECYDVLYEYFTKGVAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	114 (108)
Sequences:	2654 (2223)
Seq/√Len:	213.9
META:	0.852

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_D	102_D	3.516	1.00
52_V	55_T	3.031	1.00
75_G	78_F	2.647	1.00
38_R	42_K	2.602	1.00
35_S	38_R	2.356	1.00
8_D	92_K	2.175	1.00
56_V	63_Q	2.159	1.00
44_D	97_Q	1.999	1.00
58_T	61_G	1.920	1.00
60_G	63_Q	1.841	1.00
36_S	39_R	1.814	1.00
57_P	61_G	1.780	1.00
105_Y	109_T	1.743	1.00
39_R	55_T	1.742	1.00
49_S	98_R	1.736	1.00
33_D	36_S	1.722	1.00
34_W	38_R	1.722	1.00
38_R	66_L	1.693	1.00
35_S	51_V	1.677	1.00
59_D	63_Q	1.668	1.00
4_P	7_G	1.609	1.00
27_C	76_W	1.499	1.00
35_S	39_R	1.439	1.00
53_E	64_E	1.439	1.00
26_I	73_L	1.376	1.00
102_D	106_E	1.375	1.00
75_G	101_Y	1.365	1.00
22_P	67_C	1.356	1.00
81_N	84_R	1.337	1.00
22_P	25_P	1.330	1.00
57_P	63_Q	1.321	1.00
12_A	19_I	1.305	1.00
40_R	79_G	1.303	1.00
33_D	55_T	1.297	1.00
6_H	95_R	1.296	1.00
100_C	104_L	1.286	1.00
20_Y	67_C	1.271	1.00
18_E	69_P	1.268	1.00
36_S	52_V	1.217	1.00
94_I	97_Q	1.200	1.00
36_S	40_R	1.199	1.00
14_E	17_G	1.190	1.00
106_E	110_K	1.181	1.00
27_C	32_L	1.175	1.00
74_P	105_Y	1.166	1.00
40_R	43_R	1.157	1.00
56_V	61_G	1.150	1.00
72_Y	98_R	1.149	1.00
12_A	108_F	1.113	1.00
95_R	99_E	1.110	1.00
35_S	55_T	1.100	1.00
36_S	55_T	1.070	1.00
79_G	97_Q	1.064	1.00
45_E	94_I	1.062	1.00
45_E	97_Q	1.052	1.00
33_D	39_R	1.039	1.00
50_G	63_Q	1.026	1.00
39_R	43_R	1.003	1.00
78_F	101_Y	1.003	1.00
23_L	41_I	1.001	1.00
4_P	9_E	1.000	1.00
57_P	65_M	0.999	1.00
78_F	100_C	0.966	1.00
39_R	52_V	0.953	1.00
72_Y	101_Y	0.944	1.00
30_L	93_L	0.940	0.99
56_V	60_G	0.933	0.99
24_K	34_W	0.912	0.99
33_D	52_V	0.912	0.99
56_V	59_D	0.900	0.99
103_V	107_Y	0.895	0.99
44_D	79_G	0.888	0.99
82_P	85_V	0.876	0.99
69_P	72_Y	0.872	0.99
8_D	29_A	0.869	0.99
45_E	83_N	0.868	0.99
29_A	96_Y	0.866	0.99
39_R	54_I	0.861	0.99
21_V	26_I	0.861	0.99
51_V	54_I	0.858	0.99
32_L	80_I	0.852	0.99
58_T	63_Q	0.851	0.99
85_V	93_L	0.845	0.99
23_L	34_W	0.842	0.99
50_G	56_V	0.833	0.99
70_L	73_L	0.824	0.99
86_K	89_L	0.818	0.99
55_T	62_P	0.804	0.98
51_V	66_L	0.800	0.98
24_K	28_E	0.797	0.98
87_P	90_R	0.793	0.98
91_E	94_I	0.793	0.98
91_E	95_R	0.790	0.98
46_V	97_Q	0.786	0.98
47_L	101_Y	0.771	0.98
89_L	93_L	0.769	0.98
8_D	96_Y	0.756	0.98
71_D	105_Y	0.751	0.98
15_E	19_I	0.740	0.97
44_D	47_L	0.736	0.97
82_P	97_Q	0.720	0.97
50_G	61_G	0.719	0.97
36_S	54_I	0.718	0.97
82_P	94_I	0.716	0.97
69_P	73_L	0.708	0.96
36_S	43_R	0.706	0.96
50_G	72_Y	0.698	0.96
53_E	66_L	0.698	0.96
38_R	51_V	0.697	0.96
14_E	20_Y	0.696	0.96
96_Y	100_C	0.689	0.96
70_L	105_Y	0.687	0.96
50_G	57_P	0.677	0.95
34_W	66_L	0.665	0.95
14_E	19_I	0.663	0.95
35_S	52_V	0.659	0.95
23_L	27_C	0.652	0.94
5_F	10_L	0.646	0.94
43_R	83_N	0.641	0.94
107_Y	110_K	0.636	0.94
92_K	95_R	0.634	0.94
89_L	92_K	0.632	0.93
37_Q	40_R	0.632	0.93
25_P	28_E	0.630	0.93
90_R	94_I	0.617	0.93
41_I	66_L	0.615	0.93
49_S	63_Q	0.614	0.93
21_V	70_L	0.613	0.92
11_L	25_P	0.610	0.92
22_P	26_I	0.607	0.92
94_I	98_R	0.594	0.91
57_P	60_G	0.593	0.91
85_V	90_R	0.592	0.91
85_V	89_L	0.592	0.91
58_T	65_M	0.590	0.91
99_E	107_Y	0.586	0.91
42_K	51_V	0.584	0.91
27_C	37_Q	0.583	0.90
46_V	94_I	0.580	0.90
106_E	109_T	0.574	0.90
9_E	12_A	0.566	0.89
15_E	18_E	0.557	0.88
45_E	82_P	0.556	0.88
23_L	66_L	0.556	0.88
75_G	100_C	0.548	0.88
100_C	107_Y	0.544	0.87
50_G	69_P	0.544	0.87
102_D	105_Y	0.540	0.87
54_I	67_C	0.539	0.87
19_I	70_L	0.538	0.87
25_P	29_A	0.529	0.86
46_V	72_Y	0.529	0.86
85_V	91_E	0.523	0.85
56_V	65_M	0.520	0.85
51_V	55_T	0.517	0.84
47_L	50_G	0.516	0.84
54_I	84_R	0.515	0.84
74_P	101_Y	0.513	0.84
7_G	92_K	0.510	0.84
18_E	71_D	0.507	0.83
37_Q	76_W	0.506	0.83
6_H	11_L	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1j9iA	2	0.5965	32.8	0.896	Contact Map
1z4hA	1	0.5789	22.8	0.904	Contact Map
1z3iX	4	0.6754	20.9	0.905	Contact Map
1spuA	2	0.8158	19.4	0.906	Contact Map
3tgnA	2	0.886	17.1	0.909	Contact Map
2dbbA	4	0.8947	16.7	0.909	Contact Map
4un1A	1	0.8596	15.4	0.911	Contact Map
3rh2A	2	1	14.9	0.911	Contact Map
1y6uA	1	0.5175	14.6	0.912	Contact Map
2a61A	2	0.9386	14.1	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.