P63C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

P63C - P63C domain

PFAM:	PF10546	Sequences: ILEAYIAKELRPWVKTFPDEFYKEIFRLRGWPYPPGSVKKRPQYVGKLTNDLVYERLAPGVLEELKEKNPKDEKGRRKHKHHQWLTEDIGHPKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	94 (92)
Sequences:	3716 (2512)
Seq/√Len:	261.9
META:	0.941

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_Y	49_T	3.377	1.00
64_E	67_E	3.181	1.00
50_N	66_K	3.166	1.00
80_K	83_Q	3.132	1.00
69_N	81_H	2.912	1.00
24_E	27_R	2.606	1.00
29_R	48_L	2.094	1.00
79_H	84_W	2.067	1.00
44_Y	48_L	2.020	1.00
55_E	62_L	1.949	1.00
15_K	19_D	1.777	1.00
7_A	11_R	1.725	1.00
72_D	76_R	1.699	1.00
64_E	68_K	1.661	1.00
31_W	44_Y	1.590	1.00
51_D	56_R	1.520	1.00
31_W	45_V	1.511	1.00
68_K	84_W	1.493	1.00
62_L	66_K	1.484	1.00
21_F	49_T	1.457	1.00
50_N	62_L	1.442	1.00
63_E	67_E	1.407	1.00
11_R	87_E	1.379	1.00
26_F	41_R	1.360	1.00
69_N	84_W	1.342	1.00
19_D	33_Y	1.314	1.00
3_E	8_K	1.286	1.00
7_A	10_L	1.284	1.00
16_T	82_H	1.283	1.00
69_N	77_R	1.282	1.00
25_I	45_V	1.280	1.00
21_F	25_I	1.251	1.00
72_D	78_K	1.240	1.00
16_T	91_H	1.236	1.00
77_R	81_H	1.229	1.00
88_D	91_H	1.206	1.00
71_K	77_R	1.199	1.00
63_E	66_K	1.196	1.00
20_E	23_K	1.150	1.00
72_D	75_G	1.086	1.00
10_L	79_H	1.086	1.00
25_I	48_L	1.080	1.00
11_R	16_T	1.040	1.00
20_E	24_E	1.036	1.00
38_V	41_R	1.018	1.00
46_G	50_N	0.974	1.00
44_Y	47_K	0.965	1.00
65_L	81_H	0.959	1.00
52_L	56_R	0.950	1.00
48_L	52_L	0.943	1.00
26_F	42_P	0.932	1.00
51_D	55_E	0.924	1.00
26_F	31_W	0.914	1.00
36_G	41_R	0.914	1.00
26_F	38_V	0.903	1.00
36_G	39_K	0.885	1.00
43_Q	46_G	0.879	1.00
34_P	37_S	0.872	1.00
66_K	77_R	0.870	1.00
70_P	77_R	0.868	1.00
13_W	82_H	0.861	1.00
3_E	11_R	0.852	1.00
19_D	41_R	0.835	0.99
6_I	68_K	0.829	0.99
5_Y	58_A	0.804	0.99
57_L	61_V	0.799	0.99
25_I	52_L	0.799	0.99
29_R	44_Y	0.795	0.99
58_A	61_V	0.783	0.99
58_A	93_K	0.779	0.99
5_Y	93_K	0.772	0.99
34_P	38_V	0.770	0.99
2_L	5_Y	0.767	0.99
26_F	45_V	0.766	0.99
77_R	84_W	0.764	0.99
89_I	93_K	0.764	0.99
11_R	14_V	0.750	0.99
45_V	48_L	0.743	0.99
25_I	31_W	0.737	0.99
6_I	86_T	0.730	0.98
32_P	35_P	0.727	0.98
66_K	81_H	0.724	0.98
43_Q	47_K	0.720	0.98
60_G	63_E	0.719	0.98
51_D	59_P	0.718	0.98
25_I	29_R	0.716	0.98
13_W	16_T	0.716	0.98
51_D	58_A	0.708	0.98
43_Q	48_L	0.706	0.98
47_K	50_N	0.702	0.98
6_I	10_L	0.700	0.98
77_R	83_Q	0.699	0.98
69_N	79_H	0.692	0.98
50_N	55_E	0.682	0.98
24_E	28_L	0.675	0.97
47_K	51_D	0.667	0.97
15_K	18_P	0.665	0.97
33_Y	36_G	0.663	0.97
35_P	39_K	0.655	0.97
87_E	91_H	0.655	0.97
71_K	76_R	0.655	0.97
29_R	51_D	0.651	0.97
88_D	92_P	0.643	0.97
35_P	38_V	0.631	0.96
79_H	83_Q	0.627	0.96
22_Y	26_F	0.627	0.96
64_E	91_H	0.618	0.96
82_H	91_H	0.599	0.95
33_Y	39_K	0.593	0.95
8_K	12_P	0.589	0.95
13_W	19_D	0.586	0.94
75_G	80_K	0.585	0.94
29_R	52_L	0.583	0.94
3_E	6_I	0.582	0.94
31_W	47_K	0.581	0.94
50_N	81_H	0.572	0.94
73_E	76_R	0.572	0.94
81_H	84_W	0.570	0.94
72_D	77_R	0.569	0.93
3_E	14_V	0.560	0.93
7_A	12_P	0.558	0.93
47_K	55_E	0.557	0.93
29_R	49_T	0.549	0.92
79_H	82_H	0.547	0.92
8_K	11_R	0.546	0.92
7_A	87_E	0.545	0.92
74_K	78_K	0.537	0.91
6_I	14_V	0.536	0.91
12_P	93_K	0.530	0.91
42_P	54_Y	0.527	0.91
76_R	80_K	0.523	0.90
32_P	36_G	0.520	0.90
39_K	43_Q	0.516	0.90
57_L	85_L	0.511	0.89
33_Y	37_S	0.511	0.89
85_L	89_I	0.504	0.89
6_I	85_L	0.501	0.88
23_K	32_P	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3v5wA	1	0.8511	10.8	0.908	Contact Map
4in3B	1	0.383	10.3	0.909	Contact Map
2gigA	2	0.6489	7.6	0.914	Contact Map
1hc1A	5	0.9362	7.6	0.914	Contact Map
1pp7U	1	0.5	7.5	0.914	Contact Map
2h2wA	2	0.5638	7	0.916	Contact Map
3wkyA	5	0.9362	6.3	0.917	Contact Map
3iykA	3	0.383	5.8	0.918	Contact Map
3gwjA	5	0.9149	5.7	0.919	Contact Map
3ixvA	9	0.9255	4.5	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.