ORF6N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ORF6N - ORF6N domain

PFAM:	PF10543	Sequences: NKIYLIRGQKVMLDSDLAELYGVETKRLNQAVKRNIERFPEDFMFQLTKEEFERSQIVTSSRGGGRRYLPYAFTEQGVAMLSSV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (83)
Sequences:	31705 (17968)
Seq/√Len:	1972.2
META:	0.965

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_R	30_Q	4.198	1.00
30_Q	55_S	2.716	1.00
26_K	59_T	2.689	1.00
30_Q	58_V	2.477	1.00
55_S	58_V	2.400	1.00
54_R	68_Y	2.223	1.00
76_Q	79_A	2.036	1.00
5_L	10_K	2.036	1.00
27_R	31_A	1.687	1.00
44_M	71_Y	1.653	1.00
46_Q	71_Y	1.648	1.00
60_S	65_G	1.613	1.00
27_R	58_V	1.567	1.00
26_K	54_R	1.537	1.00
2_K	19_E	1.529	1.00
49_K	53_E	1.486	1.00
65_G	68_Y	1.475	1.00
49_K	69_L	1.468	1.00
54_R	59_T	1.419	1.00
33_K	71_Y	1.407	1.00
54_R	60_S	1.405	1.00
26_K	30_Q	1.388	1.00
79_A	82_S	1.356	1.00
29_N	46_Q	1.352	1.00
24_E	27_R	1.328	1.00
32_V	44_M	1.320	1.00
25_T	29_N	1.310	1.00
4_Y	12_M	1.294	1.00
79_A	83_S	1.254	1.00
62_R	65_G	1.247	1.00
27_R	55_S	1.232	1.00
32_V	73_F	1.206	1.00
60_S	67_R	1.198	1.00
63_G	67_R	1.195	1.00
4_Y	16_D	1.164	1.00
60_S	63_G	1.158	1.00
55_S	59_T	1.152	1.00
64_G	67_R	1.130	1.00
47_L	72_A	1.109	1.00
61_S	65_G	1.064	1.00
29_N	33_K	1.061	1.00
15_S	66_R	1.056	1.00
61_S	64_G	1.032	1.00
50_E	53_E	1.022	1.00
63_G	66_R	0.995	1.00
34_R	56_Q	0.980	1.00
2_K	5_L	0.972	1.00
29_N	71_Y	0.969	1.00
52_F	69_L	0.954	1.00
60_S	64_G	0.952	1.00
7_R	51_E	0.950	1.00
52_F	66_R	0.916	1.00
23_V	28_L	0.886	1.00
52_F	70_P	0.880	1.00
34_R	58_V	0.879	1.00
78_V	82_S	0.878	1.00
5_L	9_Q	0.877	1.00
57_I	60_S	0.871	1.00
12_M	81_L	0.845	1.00
28_L	44_M	0.844	1.00
60_S	68_Y	0.839	1.00
42_D	83_S	0.830	1.00
62_R	66_R	0.830	1.00
29_N	66_R	0.819	1.00
36_I	44_M	0.814	1.00
14_D	25_T	0.802	1.00
16_D	19_E	0.797	1.00
64_G	68_Y	0.789	1.00
49_K	52_F	0.767	1.00
56_Q	60_S	0.751	1.00
80_M	83_S	0.749	1.00
13_L	72_A	0.744	1.00
56_Q	59_T	0.734	1.00
46_Q	69_L	0.732	1.00
60_S	66_R	0.726	1.00
23_V	27_R	0.720	1.00
62_R	67_R	0.717	1.00
33_K	36_I	0.709	1.00
31_A	34_R	0.708	1.00
76_Q	83_S	0.697	1.00
5_L	8_G	0.684	1.00
12_M	16_D	0.683	1.00
43_F	76_Q	0.673	1.00
26_K	55_S	0.672	1.00
52_F	63_G	0.667	1.00
57_I	65_G	0.666	1.00
17_L	78_V	0.664	1.00
61_S	66_R	0.661	1.00
28_L	81_L	0.657	1.00
24_E	30_Q	0.643	1.00
41_E	50_E	0.636	1.00
23_V	31_A	0.635	1.00
54_R	67_R	0.633	1.00
2_K	16_D	0.627	1.00
21_Y	78_V	0.626	1.00
61_S	67_R	0.619	1.00
9_Q	41_E	0.615	1.00
26_K	58_V	0.613	1.00
2_K	9_Q	0.601	1.00
76_Q	82_S	0.599	1.00
40_P	43_F	0.590	1.00
38_R	83_S	0.583	1.00
17_L	28_L	0.578	1.00
20_L	82_S	0.568	1.00
78_V	81_L	0.567	1.00
54_R	66_R	0.563	1.00
54_R	64_G	0.562	1.00
18_A	28_L	0.555	1.00
75_E	78_V	0.546	1.00
63_G	68_Y	0.537	1.00
59_T	68_Y	0.535	1.00
14_D	29_N	0.533	1.00
33_K	46_Q	0.529	1.00
30_Q	33_K	0.526	1.00
54_R	65_G	0.526	1.00
44_M	72_A	0.524	1.00
55_S	60_S	0.520	1.00
37_E	41_E	0.519	1.00
46_Q	70_P	0.518	1.00
3_I	12_M	0.517	1.00
45_F	72_A	0.508	1.00
20_L	78_V	0.505	1.00
31_A	55_S	0.500	1.00
62_R	68_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y6uA	1	0.6667	42.5	0.852	Contact Map
1twfB	2	0.881	36.5	0.858	Contact Map
3h0gB	1	0.9048	33.4	0.86	Contact Map
1hsjA	2	0.8095	26.5	0.867	Contact Map
4c2mB	1	0.8929	24.4	0.87	Contact Map
2o38A	2	0.8333	23.8	0.87	Contact Map
4qiwB	1	0.9048	23.3	0.871	Contact Map
3g3zA	2	0.7738	22.8	0.871	Contact Map
2ethA	4	0.8095	22.7	0.871	Contact Map
2nyxA	2	0.8095	22.7	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.