DM13 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DM13 - Electron transfer DM13

PFAM:	PF10517	Sequences: EFVSDAHWTSGTATIYEDRVLRLEDFSTDSNGPDLHVYLSPAPDPTGDGFTVKDAGFVDLGPLKGNKGDQYEIPLPAGVDLSDYRSVVIWCERFSVLFGAAPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	103 (96)
Sequences:	9115 (5764)
Seq/√Len:	588.3
META:	0.885

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_H	59_D	3.544	1.00
9_T	99_G	3.352	1.00
36_H	92_E	2.995	1.00
27_S	67_K	2.549	1.00
20_V	72_E	2.418	1.00
36_H	62_P	2.317	1.00
80_D	83_D	2.270	1.00
14_T	24_E	2.231	1.00
97_L	100_A	2.141	1.00
91_C	94_F	1.870	1.00
41_P	83_D	1.842	1.00
33_P	94_F	1.800	1.00
32_G	98_F	1.754	1.00
35_L	98_F	1.715	1.00
88_V	97_L	1.637	1.00
9_T	28_T	1.622	1.00
34_D	92_E	1.529	1.00
59_D	92_E	1.521	1.00
10_S	27_S	1.518	1.00
16_Y	22_R	1.512	1.00
58_V	79_V	1.511	1.00
40_S	88_V	1.496	1.00
37_V	89_I	1.496	1.00
33_P	91_C	1.482	1.00
32_G	35_L	1.476	1.00
39_L	84_Y	1.460	1.00
12_T	24_E	1.457	1.00
23_L	26_F	1.423	1.00
41_P	56_G	1.392	1.00
21_L	87_V	1.381	1.00
90_W	97_L	1.377	1.00
14_T	22_R	1.361	1.00
34_D	93_R	1.349	1.00
8_W	30_S	1.346	1.00
90_W	95_S	1.326	1.00
92_E	95_S	1.309	1.00
23_L	37_V	1.286	1.00
19_R	81_L	1.244	1.00
25_D	69_D	1.238	1.00
38_Y	57_F	1.213	1.00
40_S	86_S	1.207	1.00
37_V	87_V	1.197	1.00
58_V	84_Y	1.156	1.00
24_E	69_D	1.100	1.00
43_P	86_S	1.068	1.00
21_L	73_I	1.047	1.00
28_T	99_G	1.006	1.00
35_L	89_I	1.003	1.00
12_T	25_D	0.994	1.00
59_D	62_P	0.990	1.00
88_V	100_A	0.977	1.00
31_N	66_N	0.936	1.00
25_D	68_G	0.923	1.00
22_R	69_D	0.907	1.00
49_G	52_V	0.885	1.00
28_T	35_L	0.871	1.00
5_D	100_A	0.850	1.00
79_V	84_Y	0.849	1.00
41_P	85_R	0.841	1.00
31_N	35_L	0.840	1.00
42_A	85_R	0.831	1.00
73_I	79_V	0.829	1.00
33_P	93_R	0.824	1.00
13_A	87_V	0.793	1.00
6_A	96_V	0.791	1.00
36_H	93_R	0.788	1.00
5_D	8_W	0.788	1.00
62_P	92_E	0.780	1.00
43_P	85_R	0.780	1.00
40_S	57_F	0.775	1.00
86_S	102_P	0.774	1.00
16_Y	19_R	0.773	1.00
17_E	20_V	0.765	1.00
39_L	87_V	0.762	1.00
39_L	79_V	0.755	1.00
7_H	32_G	0.754	1.00
38_Y	90_W	0.748	1.00
5_D	97_L	0.742	1.00
50_F	53_K	0.734	1.00
63_L	70_Q	0.731	1.00
47_G	51_T	0.727	1.00
49_G	53_K	0.723	1.00
23_L	68_G	0.710	1.00
48_D	51_T	0.709	1.00
8_W	27_S	0.708	1.00
65_G	70_Q	0.707	1.00
30_S	99_G	0.700	1.00
7_H	30_S	0.698	1.00
30_S	66_N	0.695	1.00
16_Y	20_V	0.694	1.00
7_H	96_V	0.693	1.00
41_P	84_Y	0.686	1.00
76_P	79_V	0.686	1.00
68_G	71_Y	0.684	1.00
34_D	62_P	0.681	1.00
37_V	63_L	0.680	1.00
97_L	102_P	0.674	1.00
64_K	71_Y	0.673	1.00
19_R	79_V	0.671	1.00
35_L	63_L	0.669	1.00
32_G	94_F	0.660	1.00
73_I	81_L	0.657	1.00
58_V	78_G	0.656	1.00
44_D	102_P	0.649	1.00
28_T	98_F	0.646	1.00
23_L	89_I	0.644	1.00
26_F	69_D	0.635	1.00
66_N	70_Q	0.633	1.00
94_F	98_F	0.626	1.00
47_G	96_V	0.620	1.00
22_R	25_D	0.613	1.00
26_F	89_I	0.610	1.00
40_S	85_R	0.605	1.00
46_T	49_G	0.602	1.00
42_A	51_T	0.596	1.00
32_G	91_C	0.594	1.00
47_G	50_F	0.593	1.00
38_Y	88_V	0.591	1.00
19_R	72_E	0.585	1.00
31_N	67_K	0.577	1.00
15_I	19_R	0.566	1.00
79_V	83_D	0.565	1.00
7_H	94_F	0.564	1.00
20_V	24_E	0.555	0.99
22_R	72_E	0.545	0.99
64_K	70_Q	0.545	0.99
9_T	89_I	0.543	0.99
93_R	96_V	0.542	0.99
52_V	88_V	0.542	0.99
28_T	66_N	0.541	0.99
90_W	96_V	0.541	0.99
27_S	68_G	0.540	0.99
45_P	49_G	0.534	0.99
81_L	84_Y	0.530	0.99
99_G	102_P	0.529	0.99
63_L	68_G	0.528	0.99
87_V	101_A	0.524	0.99
19_R	78_G	0.521	0.99
38_Y	92_E	0.519	0.99
6_A	30_S	0.518	0.99
86_S	100_A	0.514	0.99
27_S	30_S	0.513	0.99
53_K	57_F	0.501	0.99
42_A	45_P	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ueyA	1	0.5437	21.6	0.881	Contact Map
4q6kA	4	0.6893	7.8	0.903	Contact Map
2f68X	1	0.7476	6.3	0.907	Contact Map
2cclA	1	0.4369	6.2	0.907	Contact Map
2ygoA	2	0.6796	6	0.908	Contact Map
2ljkA	1	0.4175	5.1	0.911	Contact Map
4uypA	2	0.4369	4.2	0.914	Contact Map
3kwuA	1	0.7573	3.8	0.916	Contact Map
2ygnA	2	0.6796	3.8	0.916	Contact Map
4j1vA	1	0.3398	3.7	0.916	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.