WGG - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

WGG - Pre-rRNA-processing protein TSR2

PFAM:	PF10273	Sequences: FEEGVALVLSRWTALQLAVENGWGGPDSAEKRDWLAGAIVDLFKSNPDLDADDLEDFLLQVMEDEFNTVVEDGSAEEVAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	80 (79)
Sequences:	751 (558)
Seq/√Len:	62.7
META:	0.336

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_G	31_K	3.456	1.00
35_L	61_V	2.482	1.00
19_V	28_S	2.457	1.00
8_V	78_V	2.431	1.00
13_T	17_L	2.258	1.00
9_L	39_I	2.209	1.00
34_W	38_A	2.180	1.00
25_G	28_S	2.141	1.00
73_G	76_E	2.103	1.00
59_L	75_A	1.966	1.00
24_G	28_S	1.879	1.00
25_G	31_K	1.822	1.00
3_E	7_L	1.732	0.99
17_L	68_T	1.697	0.99
70_V	75_A	1.631	0.99
27_D	30_E	1.616	0.99
34_W	65_E	1.607	0.99
34_W	61_V	1.604	0.99
62_M	70_V	1.550	0.99
19_V	32_R	1.547	0.99
5_V	40_V	1.537	0.99
60_Q	64_D	1.448	0.98
61_V	65_E	1.391	0.97
39_I	57_F	1.379	0.97
63_E	69_V	1.315	0.96
55_E	76_E	1.300	0.96
18_A	23_W	1.264	0.95
9_L	36_A	1.256	0.95
53_D	56_D	1.208	0.94
22_G	59_L	1.193	0.94
55_E	59_L	1.133	0.92
4_G	8_V	1.115	0.91
38_A	65_E	1.064	0.89
1_F	43_F	1.058	0.89
21_N	68_T	1.053	0.88
6_A	10_S	1.039	0.88
19_V	29_A	1.033	0.88
15_L	28_S	1.016	0.87
10_S	32_R	1.014	0.87
29_A	33_D	1.010	0.86
4_G	7_L	1.008	0.86
62_M	68_T	1.008	0.86
28_S	31_K	0.992	0.85
24_G	62_M	0.979	0.85
53_D	57_F	0.971	0.84
38_A	61_V	0.959	0.83
16_Q	20_E	0.944	0.82
42_L	49_L	0.926	0.81
12_W	15_L	0.881	0.78
38_A	41_D	0.881	0.78
74_S	79_A	0.866	0.77
2_E	40_V	0.843	0.75
38_A	57_F	0.840	0.74
34_W	37_G	0.815	0.72
19_V	26_P	0.814	0.72
16_Q	49_L	0.788	0.69
2_E	6_A	0.784	0.69
31_K	34_W	0.767	0.67
3_E	6_A	0.764	0.67
4_G	23_W	0.759	0.67
42_L	53_D	0.753	0.66
33_D	39_I	0.749	0.66
26_P	67_N	0.747	0.65
22_G	67_N	0.739	0.65
31_K	65_E	0.737	0.64
14_A	17_L	0.728	0.63
52_D	56_D	0.726	0.63
14_A	72_D	0.723	0.63
38_A	70_V	0.718	0.62
22_G	26_P	0.715	0.62
4_G	43_F	0.711	0.62
61_V	66_F	0.707	0.61
59_L	63_E	0.705	0.61
23_W	31_K	0.703	0.61
33_D	37_G	0.697	0.60
4_G	62_M	0.695	0.60
16_Q	32_R	0.689	0.59
55_E	75_A	0.682	0.58
59_L	69_V	0.670	0.57
30_E	34_W	0.665	0.56
46_N	49_L	0.661	0.56
2_E	5_V	0.651	0.55
40_V	43_F	0.649	0.55
23_W	28_S	0.646	0.54
42_L	57_F	0.644	0.54
45_S	51_A	0.640	0.54
68_T	75_A	0.634	0.53
27_D	68_T	0.627	0.52
55_E	73_G	0.622	0.52
15_L	54_L	0.619	0.51
28_S	32_R	0.617	0.51
60_Q	78_V	0.614	0.51
2_E	7_L	0.613	0.50
22_G	48_D	0.607	0.50
54_L	57_F	0.598	0.49
62_M	66_F	0.596	0.49
3_E	11_R	0.596	0.49
5_V	31_K	0.596	0.49
40_V	54_L	0.591	0.48
6_A	36_A	0.587	0.47
16_Q	42_L	0.568	0.45
24_G	68_T	0.567	0.45
20_E	29_A	0.562	0.45
29_A	41_D	0.557	0.44
28_S	66_F	0.554	0.44
3_E	42_L	0.551	0.43
2_E	42_L	0.536	0.42
49_L	52_D	0.535	0.42
20_E	61_V	0.527	0.41
57_F	73_G	0.525	0.40
1_F	4_G	0.524	0.40
11_R	77_E	0.522	0.40
23_W	66_F	0.509	0.39
17_L	21_N	0.508	0.39
3_E	8_V	0.505	0.38
51_A	56_D	0.501	0.38
51_A	59_L	0.500	0.38
56_D	75_A	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1u84A	1	0.85	49	0.85	Contact Map
2y1eA	2	0.9875	28	0.869	Contact Map
4wj3B	2	0.725	19.9	0.878	Contact Map
1q0qA	2	0.9625	17.2	0.881	Contact Map
4zn6A	2	0.9625	15.2	0.884	Contact Map
1r0kA	2	0.9625	14.9	0.884	Contact Map
4oiyA	1	0.55	13.9	0.886	Contact Map
3au8A	2	0.975	13.2	0.887	Contact Map
4y67A	2	0.975	12.5	0.888	Contact Map
3kfuF	2	0.7625	10.6	0.892	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.